Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069189 (Zdhhc11)
Chromosomal location
Chr 13: 74101310 - 74130288 (+)
Description
zinc finger, DHHC domain containing 11 Gene [Source:MGI Symbol;Acc:MGI:1918414]
RefSeq_dna
NM_027704 
RefSeq_peptide
NP_081980.1 
MGI
MGI:1918414 
Uniprot/SPTREMBL
Q14AK4 
Human Ortholog
ENSG00000206077 (AC026740.6-201)
Omim not available
UniTrap UNI13817
Vector Insertion
Chr 13: 74129579 - 74130085
Public Clones CMHD-GT_238B9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091493
Sequence
GGGAACGCCCTACCACTGTTTAACATGTCAGCACTGAGCAAGAAGTGCTGTTCAACCTGATGAAAGAG ATGAACATCTGTGGCATCAACAAGAACTGGG

TCCTCCCAGAAGCCCAGGAAAACAATGTGAAGAAGTTCCTACCACGCCCTCTGTCTAGGGTGAATGGCTGGTCACCACCCCTCCACTCCTTTCAGGCAAT

ATCCTGGATCACCTACCTGGCCATGTCCATTGTCACCTTTGGGATCTTCATCCCCTTTCTGCCATATAGCTGGAAATATGCTGCCAATATT GTGATGGG

TGGGGTGTTCATATTCCACCTCATCGTGCACTTGATCGCAATTACCATCGATCCAGCTGACACCAATGTCCGACTCAAAAAGGACTACACGCAGCCTGTG

CCGGCCTTCGACAGGTCCAAACACACACACGTGATTCAGAACCAGTACTGCCACCTGTGTGAGGTTACCGC GAGCAAAAAAGCCAAACATTGCAGCGCC

TGCAACAAATGTGTCTCTGGCTTTGACCACCACTGCAAATGGCTGAACAACTGCGTGGGCAGGAGAAACTACTG GTTCTTTTTCTGGTCTGTGGCCTCA

GCTGCAGTTGGGATTCTTGGTGTGATGATTATCTTGTGTTATATCTGCATCCAGTACTTTGTCAACCCTGATGAGCTTCGCACGGATCCTCTCTATAAAG

 AGATCATCTCTGAGAACACATGGCTGCTGTTCCTCTCACTGTGGCCTGTGCCTGTGAAGACCCCCATAGTCCTTTCCATCGCGGTGATGGCACTGCTAC

TAGCTATTGCCAGCTTCGTGATGCTTGGGCACCTCCTCATCTTCCACTTATACCTGA TTACTAAGAATATGAGCACATTTGACTACCTGATGAAGACTC

GATTCAAGAAGAATTTACATCCAGCAGAGGAGAAAGAGCTACCTCTACAGAAGAAGGGGGACCTTCCCCAG GAAAAGAGTGACAACTGGGCCTGGCCGA

AGTCCCCACCCAG AGTGGGGTCCCAGAAGTTCCCAGTGTCTACTCTTTCGCCGAAGTCAAGTGTGTGTTTTGTGGCTTCACCTCCAAAGATCTGCCACA

GTGAAG - UNI13817 - ACTAGTGGCAAGGATGAGCCCTTCTTTCATCATGGAAACACCAAGGTATCAGCCCAAGATCATGAGGAGACCCTTCTACT

CTGTGGTGCATGATGCTGCTGAGCCATGATCTTCAGTAGAATATGTGTATTATGTGTATTTTGGACTTAAGATATTTTCAATTTATGATGAGTTCCTCAG

AATGCAAAGCCGTTGTCATCCAA
Translation
MKE MNICGINKNWVLPEAQENNVKKFLPRPLSRVNGWSPPLHSFQAISWITYLAMSIVTFGIFIPFLPYSWKYAANI VMGGVFIFHLIVHLIAITIDP

ADTNVRLKKDYTQPVPAFDRSKHTHVIQNQYCHLCEVTA ASKKAKHCSACNKCVSGFDHHCKWLNNCVGRRNYW WFFFWSVASAAVGILGVMIILCYI

CIQYFVNPDELRTDPLYKE EIISENTWLLFLSLWPVPVKTPIVLSIAVMALLLAIASFVMLGHLLIFHLYLI ITKNMSTFDYLMKTRFKKNLHPAEEK

ELPLQKKGDLPQ EKSDNWAWPKSPPR RVGSQKFPVSTLSPKSSVCFVASPPKICHSED - UNI13817 - D

For any suggestions or comments, please send an email to unitrap@crg.es