Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069208 (Zfp825)
Chromosomal location
Chr 13: 74617502 - 74631418 (-)
Description
zinc finger protein 825 Gene [Source:MGI Symbol;Acc:MGI:2385315]
Human Ortholog
not available
Omim not available
UniTrap UNI35925
Vector Insertion
Chr 13: 74620264 - 74631419
Public Clones (sanger) 3SD054G06 (ggtc) 5SD054G06 (ggtc) IST15069B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074369
Sequence
GGAAGCCTTACTGGAAGTTTGTTTTTTGCTGTACAGGCTTGAATGTTTCTCCGTGTCTTCTTTGAGCGCTGCTATTGGGTGCTGTGAGGGGACGTCAAGT

AAGCTCCGTTTTTGAAACATG - UNI35925 - GATGCAGTGACTTATGATGATGTGCGTGTGAACTTCACTGAGGAAGAGTGGGATTTGCTGGATCC

TTCCCAGAAAAGTCTCTATGAAGAGGTGATGCTGGAGACCTACCAGAACATCACTGCTATAG - UNI35925 - GCTACAAGTGGGAAGACCATCATA

TTGAAGAATATTGTCAAAGTTCTAGAAGACATGAAAG GCATGAAAGAATTCATATTGGAGAGAAACCCTATGAACGTAACCAATGTGGTAAAGCCTTTG

CAAGTGACAATCATCTCCAAATACATAAAAGAACAAATACTGAAGAGAAACCTTATGAATGTAATCAATGTGGTAAAGCCTTTTCACAACACAGTAGACT

CCAATATCATAAAAGAAGTCATACTGGAGAGAAACCCTATAAATGTAATCAGTGTGGTAAAGCCTATGGACATCACAGTAGTCTCCAGTATCATAAAAGA

AGACATACTGGAGAGAAACCTTATCACTGTAATCAATGTGATAAAGCATTTTCAGAACACAGTAGTCTTGAATATCATAAAATAACACATCTTGGAGAGA

AACCTTATGAGTGTGATCAATGTGGTAAAGCCTTTGCATGGCAGTCTAGTCTCAATATACATAAAAGAACACATTCTGGAGAGAAACCTTATGAGTGTAA

TGAATGTGGTAAAGCCTTTACACATCATGCTAGTCTCCAAAGTCATAAAAGAATACATACTGGAGAGAAACCGTATCAGTGTGATCAGTGTGGTAAAGCA

TTTGCACATCAAACGAGTCTCCAATGCCATAAAAGAACACATACTGGAGAGAAACCTTATGAATGCAATTAATGTGGTAAAGCCTTTGCAAGTCACACTC

ATCTCCAAGTACATGAAAGAACACATTTTAGAAAAAAACCTTAGAATGCAATCAATGTTGTAAAGACTTTGGATGTAAGAATAATCTCCAAAGACATAAA

GGAACATATACTGGACAGAAACCTTATGAATGTAATCAAAGTGATAAAGCCTTTGCAACTCACAGTCATCTACAATGACATAAAAACACAGAGGAGAGAA

ACCTGGGTATTGTTTACTCTGAAGCTCCACCAAGTGCAAAACAGACCCTCCCATTCCCTCCCTGGAAGACAGTTTCTTCCTGACTGCCTTTGGATCAAAA

TGCAGAACTCTCAGCTCCTTCTCCAGCATCATGTCTGCCTGCATGCTGCTGCTGTGCTTCCTGCTATGATGAAAATGGACTAAACCTCTGAAACTGTAAG

CCAGCCCCAATTAAAGGTTTGCTTTTATGAGAGTC
Translation
M - UNI35925 - DAVTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIG - UNI35925 - GYKWEDHHIEEYCQSSRRHER RHERIH

IGEKPYERNQCGKAFASDNHLQIHKRTNTEEKPYECNQCGKAFSQHSRLQYHKRSHTGEKPYKCNQCGKAYGHHSSLQYHKRRHTGEKPYHCNQCDKAFS

EHSSLEYHKITHLGEKPYECDQCGKAFAWQSSLNIHKRTHSGEKPYECNECGKAFTHHASLQSHKRIHTGEKPYQCDQCGKAFAHQTSLQCHKRTHTGEK

PYECN

For any suggestions or comments, please send an email to unitrap@crg.es