Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069729 (Arid1b)
Chromosomal location
Chr 17: 4994939 - 5347656 (+)
Description
AT rich interactive domain 1B (SWI-like) Gene [Source:MGI (curated);Acc:Arid1b-001]
UniGene
Mm.133401 Mm.367028 
MGI
MGI:1926129 
Uniprot/SPTREMBL
Q3UT39 Q6ZPV5 Q6ZWS9 
Human Ortholog
ENSG00000215714 (BX284653.17-205)
Omim not available
UniTrap UNI19911
Vector Insertion
Chr 17: 4996493 - 5040579
Public Clones not available
Private Clones OST377420 (lexicon) OST210641 (lexicon) OST132876 (lexicon) OST88789 (lexicon)
OST43456 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8682
Vector Insertion
Chr 17: 5040775 - 5097573
Public Clones RRK359 (baygenomics) IST12003F7 (tigm) IST14906G5 (tigm)
Private Clones OST431083 (lexicon) OST386052 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2777
Vector Insertion
Chr 17: 5097733 - 5126913
Public Clones (sanger) AJ0568 (sanger)
Private Clones OST462137 (lexicon) OST461639 (lexicon) OST395513 (lexicon) OST379620 (lexicon)
OST278300 (lexicon) OST26638 (lexicon) OST19684 (lexicon) OST17490 (lexicon)
OST13190 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2821
Vector Insertion
Chr 17: 5127025 - 5242827
Public Clones AG0239 (sanger) AD0848 (sanger) AG0400 (sanger) RRJ290 (baygenomics)
RRM105 (baygenomics) IST10813G4 (tigm) IST14134D6 (tigm) IST10144H7 (tigm)
IST10625C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8432
Vector Insertion
Chr 17: 5243072 - 5264031
Public Clones XH786 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9953
Vector Insertion
Chr 17: 5279383 - 5290955
Public Clones XC389 (baygenomics) IST11788C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9158
Vector Insertion
Chr 17: 5291284 - 5305748
Public Clones RRE043 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12082
Vector Insertion
Chr 17: 5305895 - 5311834
Public Clones A035E04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9799
Vector Insertion
Chr 17: 5321272 - 5321477
Public Clones RRC051 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18529
Vector Insertion
Chr 17: 5321478 - 5327275
Public Clones IST14955B7 (tigm)
Private Clones OST421309 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12028
Vector Insertion
Chr 17: 5327822 - 5332486
Public Clones A032E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092723
Sequence
ATGGCCCATAGCGCGAGCGCCGCGGCGGCCGCCAGCTCCAACAGCGCGCAGAGCGGCCGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGCGCCGCCGCGC

TGTCCTCCTCCGCCGCCGTCGCGGCCTCTTCCTCCTCGGCGGGCCCCGGCTCGACCATGGAGACCGGGCTGCTCCCCAACCACAAACTGAAAGCCGTTGG

CGAGGCCCCCGCTGCACCGCCCCATCAGCAGCACCACCACCACCATGCCCACCACCACCACCACCACCATGCCCACCACCTCCACCACCTCCACCACCAC

CACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCCGCAGCCGCCGCAGCCACAGCAGCAGCAGCCGCCGCCACCGCCGCAGCAGCAGCATCCCACTG

CCAACAACAGCCTGGGCGGTGCGGGCGGCGGCGCGCCTCAGCCCGGCCCGGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGTCGCGGGCAA

TCAGGCTGACCCGCAGGGCCAGCCTCTGCTGAGCAAACCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCAGCCGCTATGAGCAC

CCGGGCCTGGGCGCGCAGCAGCAGCCCGCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCAGCGGCCGTCTCGGAGTTTAATAATTACTATGGCAGCG

CTGCCCCTGCTAGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTC

TGCCGCCGCCGGGGCCCCCAGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTACAACCATTATCCGGGCTACAGCCGGCCC

GGCGCGGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGTGGAGGAGGAGGAGGAGCAGGAGGAGCAGGAGGAGCAGCGGCAGCGG

CAGCAGGAGCCGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGCAGCAGCAGGAGGAGGCGGTGGCGGCGGCTATGGGAGCTCGTCCTC

GGGGTACGGGGTGCTGAGCTCCCCGCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTCAGCAAGGCGGCCGCCGGC

GCGGCGGCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCTACACCGACCCTCAACCAGCTGCTCACCTCACCCAGCC

CCATGATGAGGAGCTACGGCGGTAGCTACCCCGACTACAGCAGCTCCAGCGCGCCGCCGCCGCCGTCGCAGCCCCAGTCCCAGGCGGCGGCGGGGGCGGC

GGCGGGTGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACCTAGGCGCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGG

AGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATGGGCAGATCCCAG - UNI19911 - GGCAGCCCGATGGACCCAATGGTGATGAAGAG

ACCTCAGTTGTATGGGATGGGTACTCACCCCCACTCCCAGCCACAGCAGAGCAGCCCATACCCAGGAGGCTCCTACGGTCCCCCAGGTGCACAGCGGTAT

CCCCTTGGCATGCAGGGCCGGGCTCCAGGGGCCCTGGGAGGCTTGCAGTACCCGCAGCAGCAG - UNI8682 - ATGCCACCGCAGTACGGACAGCAA

GCTGTGAGTGGCTACTGCCAGCAAGGCCAGCAGCCATACTACAACCAGCAGCCGCAGCCCTCGCACCTCCCGCCCCAGGCACAGTACCTGCAGCCGGCGG

CGGCGCAGTCCCAGCAGAGGTACCAGCCACAGCAG - UNI2777 - GACATGTCTCAAGAAGGCTATGGAACTAGATCTCAGCCTCCTCTGGCCCCTG

GAAAATCCAACCATGAAGACTTGAATTTAATTCAACAGGAAAGACCATCGAGTCTACCA - UNI2821 - GACCTGTCTGGCTCCATCGATGACCTCC

CCACGGGAACAGAAGCAACTCTGAGCTCAGCAGTCAGTGCATCCGGGTCTACAAGCAGCCAGGGAGATCAGAGCAACCCAGCGCAGTCTCCTTTCTCCCC

ACATGCATCACCTCACCTCTCCAGCATCCCTGGAGGGCCGTCACCTTCTCCTGTTGGCTCTCCTGTGGGAAGCAACCAATCGAGGTCTGGTCCGATCTCC

CCTGCGAGTATTCCAG - UNI8432 - GTAGCCAGATGCCTCCGCAACCACCTGGAAGCCAGTCAGAATCCAGTTCCCATCCTGCCTTGAGCCAGTCA

CCAATGCCACAGGAAAGAG GTTTTATGACAGGCACTCAGAGAAACCCTCAGATGTCTCAGTACGGACCTCAGCAGACAGGACCATCCATGTCGCCTCAC

CCATCTCCTGGGGGCCAGATGCATCCTGGGATCAGTAACTTTCAGCAGAGTAACTCAAGTGGCACGTACGGCCCACAGATGAGCCAGTATGGACCCCAAG

 - UNI9953 - GCAACTACTCCAGAACCCCAACATATAGCGGGGTACCCAGTGCAAGCTACAGCGGCCCAGGGCCCGGTATGGGCATCAATGCCAACA

ACCAGATGCATGGACAAGGGCCAGCCCAGCCATGTGGTGCTATGCCCCTGGGACGAATGCCTTCAGCTGGGATGCAGAACAGACCATTTCCTGGAACCAT

GAGCAGCGTCACCCCCAGTTCTCCTGGCATGTCTCAACAGGGAGGGCCAGGAATGGGCCCACCAATGCCCACTGTGAACCGGAAGGCCCAGGAAGCTGCC

GCAGCTGTGATGCAGGCTGCTGCAAACTCAGCACAAAGCAG - UNI9158 - GCAAGGCAGTTTTCCTGGCATGAACCAGAGTGGCCTGGTGGCCTCC

AGCTCTCCCTACAGCCAGTCCATGAACAACAACTCCAGCCTGATGAGCACCCAGGCCCAGCCCTACAGCATGACGCCCACAATGGTGAACAGCTCCACAG

 - UNI12082 - CATCTATGGGTCTTGCAGATATGATGTCTCCCAGTGAGTCCAAATTGTCTGTGCCTCTTAAAGCAGATGGTAAAGAAGAAGGCGTG

TCCCAGCCTGAGAGCAAGTCAAAG AAGTCCAGCTCTTCCTCCACCACTGGGGAGAAGATCACGAAGGTCTATGAGCTGGGGAATGAGCCGGAGAGGAAG

CTGTGGGTCGACCGTTACCTAACGTTCATGGAAGAGAGGGGCTCCCCGGTGTCCAGTCTGCCAGCAGTGGGCAAGAAGCCCCTGGACCTGTTCCGACTGT

ATGTCTGCGTCAAGGAGATTGGAGGTTTGGCGCAG - UNI9799 - GTTAATAAAAACAAGAAGTGGCGTGAGCTGGCAACCAACCTGAACGTTGGCA

CTTCCAGCAGCGCAGCCAGCTCTCTGAAAAAGCAGTATATTCAGTACCTGTTCGCCTTTGAGTGCAAAACTGAGCGCGGGGAGGAGCCCCCACCTGAAGT

CTTCAGCACCGGGGATTCGAAGAAGCAGCCAAAGCTCCAGCCGCCATCTCCTG - UNI18529 - CTAACTCAGGATCCTTACAAGGCCCACAGACTC

CACAGTCAACTGGGAGCAATTCGATGGCAGAGGTTCCAGGTGACCTGAAGCCACCAACCCCAGCCTCTACCCCTCATGGACAGATGACTCCCATGCAAAG

CGGAAG AAGCAGTACAGTCAGTGTGCATGACCCGTTCTCAGACGTGAGTGACTCAGCGTACCCAAAACGGAACTCCATGACTCCAAACGCCCCATACCA

GCAGGGCATGGGCATGCCAGACATGATGGGCAGGATGCCCTATGAACCCAACAAGGACCCTTTCAGTGGAATGAGAAAAG - UNI12028 - TGCCTG

GAAGTAGTGAGCCCTTTATGACACAAGGACAGGTGCCCAACAGCGGCATGCAGGACATGTACAACCAGAGCCCCTCAGGGGCCATGTCCAATCTGGGCAT

GGGACAGCGGCAGCAGTTTCCCTATGGAACCAGTTATGACCGAAG GCATGAGGCTTACGGACAGCAGTACCCAGGCCAAGGCCCTCCCACAGGACAGCC

ACCGTATGGAGGACACCAGCCTGGCCTGTACCCACAGCAGCCG AATTACAAACGTCATATGGATGGCATGTACGGGCCTCCAGCCAAGCGGCACGAGGG

AGACATGTACAACATGCAGTATGGCAGCCAGCAGCAGGAGATGTATAACCAGTATGGAGGCTCCTACTCTGGCCCGGACAGAAGGCCCATCCAGGGACAA

TATCCCTACCCCTACAACAGAGAAAGGATGCAGGGCCCAGGCCAGATGCAGCCACACGGAATCCCACCTCAGATGATGGGGGGCCCCATGCAGTCATCCT

CCAGCGAGGGGCCTCAGCAGAACATGTGGGCTACACGCAACGATATGCCTTATCCCTACCAGAGCAGGCAAGGCCCGGGCGGCCCTGCACAGGCCCCCCC

TTACCCAGGCATGAACCGCACAGATGATATGATGGTACCTGAGCAGAGGATCAATCACGAGAGCCAGTGGCCTTCTCACGTCAGCCAGCGCCAGCCTTAC

ATGTCATCTTCGGCCTCCATGCAGCCCATCACGCGCCCACCTCAGTCATCCTACCAGACGCCGCCGTCACTGCCAAACCACATCTCCAGGGCACCCAGCC

CCGCCTCCTTCCAGCGCTCCCTGGAGAGTCGCATGTCTCCAAGCAAGTCTCCCTTCCTGCCCACCATGAAGATGCAGAAGGTCATGCCCACAGTCCCCAC

ATCCCAGGTCACCGGGCCCCCCCCACAGCCTCCACCAATCAGAAGGGAGATTACCTTTCCTCCTGGCTCCGTAGAAGCATCACAGCCAATCCTGAAACAA

AGGCGAAAGATTACCTCAAAAGATATTG TTACTCCCGAGGCGTGGCGTGTGATGATGTCCCTTAAATCGGGTCTGTTGGCTGAGAGCACGTGGGCTCTG

GACACCATCAATATTCTCCTCTATGATGACAGCACCGTCGCCACCTTCAATCTTTCCCAG CTGTCTGGATTCCTGGAACTATTAGTAGAGTACTTTCGA

AAATGCCTAATTGACATTTTCGGAATTCTTATGGAATATGAAGTGGGTGACCCCAGCCAAAAGGCTCTTGATCACCGTTCAGGGAAGAAAGATGACAGCC

AGTCCCTGGAAGATGATTCTGGGAAGGAAGACGATGATGCTGAGTGTCTTGTGGAAGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGACAGTGAAAAGAT

AGAGTCAGAGGGGAAGAGCAGCCCTGCCCTAGCTGCTCCAGATGCCTCCGTGGACCCCAAGGAGACGCCAAAGCAGGCCAGTAAGTTTGACAAGCTGCCC

ATAAAGATTGTCAAAAAGAACAAGCTGTTTGTGGTGGACCGGTCCGACAAGCTGGGCCGAGTGCAGGAGTTCAGCAGCGGGCTCCTCCACTGGCAGCTGG

GTGGTGGCGACACTACCGAGCACATCCAGACTCACTTCGAGAGCAAGATGGAGATCCCTCCTCGCAGGCGTCCACCTCCGCCTCTAAGCTCCACGGGTAA

GAAGAAAGAGCTGGAAGGCAAAGGTGATTCTGAAGAGCAGCCAGAGAAAAGTATCATAGCCACCATCGATGACGTCTTGTCTGCCCGGCCAGGGGCTCTG

CCTGAAGACACCAACCCAGGACCCCAGACCGACAGCGGCAAGTTTCCCTTTGGAATCCAGCAGGCCAAAAGCCACCGGAACATCAGGCTCCTGGAAGACG

AGCCCAGGAGCCGAGACGAGACGCCGCTGTGCACCATCGCGCACTGGCAGGACTCACTGGCCAAGCGCTGCATCTGTGTGTCGAACATCGTGCGGAGCTT

GTCTTTCGTGCCTGGCAACGACGCAGAGATGTCCAAACACCCGGGCTTGGTGCTGATCCTGGGAAAGCTGATTCTGCTGCATCACGAGCATCCGGAGAGA

AAGCGGGCGCCACAGACCTATGAGAAGGAGGAGGACGAGGACAAGGGGGTGGCCTGCAGCAAAGATGAGTGGTGGTGGGACTGCCTCGAGGTCTTGCGGG

ATAACACCCTGGTCACGTTGGCGAACATTTCCGGGCAGCTAGACTTGTCTGCTTACACAGAGAGCATCTGCTTGCCGATCCTGGACGGCTTGCTACACTG

GATGGTGTGCCCGTCCGCAGAGGCTCAGGACCCCTTTCCCACTGTGGGGCCCAACTCAGTCCTGTCGCCGCAGAGACTTGTGCTGGAGACCCTGTGTAAA

CTCAGTATCCAGGACAACAACGTGGACCTGATCTTGGCCACGCCTCCATTTAGTCGTCAGGAGAAATTTTATGCTACATTAGTTAGGTACGTTGGGGATC

GCAAAAATCCAGTCTGTCGAGAAATGTCCATGGCGCTTTTATCGAACCTTGCCCAGGGGGACACACTGGCGGCGAGGGCAATAGCTGTGCAGAAAGGAAG

CATTGGTAACTTGATAAGCTTCCTAGAGGACGGGGTGACGATGGCGCAGTACCAGCAGAGCCAGCATAACCTTATGCACATGCAGCCCCCACCTCTGGAA

CCCCCTAGTGTAGACATGATGTGCCGGGCGGCCAAAGCTCTGCTGGCCATGGCCAGAGTGGACGAGAACCGCTCGGAGTTCCTTTTGCACGAGGGTCGGT

TGCTGGATATCTCAATATCAGCTGTCCTGAACTCTCTGGTTGCATCTGTCATCTGTGATGTACTGTTTCAGATTGGGCAGTTATGACATCCGTGAAGGCA

CACATGTGTGAGTGAACATTAGAGGGTCACATATAACTGGCTGTTTTCTGTTCTCGTTTATCCAGTGTAAGAAGAAGGAAAAGAAAAATCTTTGCTCCTC

TGCCCCGTTTACTATTTACCAATTGGGAATTAAATCATTAATTTGAACAGTTATAAAATTAATATTTGCTGTCTGTGTGTATAAGTACATCCTCTGGCGG

TTTTCTGTTTCTTTTTTTTTTAACCAAAGTTGCCGTCTAGTGCATTCAAAGGTCACAATTTTTGTTTGTTTGTTTGTTTGTTTGTTTTTTCATAATTTTT

TTCATGTTGTATTGCAGTCTTTGGGAAGTGAATTGACTTTATAAAGAAAAACGTTTTGGCAAAAAGTGCTAAGATAGAAAAATGTCACCACACTGGGTCA

AAAA
Translation
MAHSASAAAAASSNSAQSGRSEAALKEGGSAAALSSSAAVAASSSSAGPGSTMETGLLPNHKLKAVGEAPAAPPHQQHHHHHAHHHHHHHAHHLHHLHHH

HALQQQLNQFQQPQPPQPQQQQPPPPPQQQHPTANNSLGGAGGGAPQPGPDMEQPQHGGAKDSVAGNQADPQGQPLLSKPGDEDDAPPKMGEPAGSRYEH

PGLGAQQQPAPVAVPGGGGGPAAVSEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAGAPSSMDPLQNSHEGYPNSQYNHYPGYSRP

GAGGGGGGGGGGGGSGGGGGGGGAGGAGGAAAAAAGAGAVAAAAAAAAAAAAAAGGGGGGGYGSSSSGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAG

AAAAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPDYSSSSAPPPPSQPQSQAAAGAAAGGQQAAAGMGLGKDLGAQYAAASPAWAAAQQR

SHPAMSPGTPGPTMGRSQ - UNI19911 - GSPMDPMVMKRPQLYGMGTHPHSQPQQSSPYPGGSYGPPGAQRYPLGMQGRAPGALGGLQYPQQQ - 

UNI8682 - MPPQYGQQAVSGYCQQGQQPYYNQQPQPSHLPPQAQYLQPAAAQSQQRYQPQQ - UNI2777 - DMSQEGYGTRSQPPLAPGKSNHED

LNLIQQERPSSLP - UNI2821 - DLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGP

ISPASIPG - UNI8432 - GSQMPPQPPGSQSESSSHPALSQSPMPQERG GFMTGTQRNPQMSQYGPQQTGPSMSPHPSPGGQMHPGISNFQQSNSS

GTYGPQMSQYGPQG - UNI9953 - GNYSRTPTYSGVPSASYSGPGPGMGINANNQMHGQGPAQPCGAMPLGRMPSAGMQNRPFPGTMSSVTPSSPGM

SQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR - UNI9158 - RQGSFPGMNQSGLVASSSPYSQSMNNNSSLMSTQAQPYSMTPTMVNSSTA

 - UNI12082 - ASMGLADMMSPSESKLSVPLKADGKEEGVSQPESKSK KSSSSSTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAV

GKKPLDLFRLYVCVKEIGGLAQ - UNI9799 - VNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPPPEVFSTGDSKKQPKLQP

PSPA - UNI18529 - ANSGSLQGPQTPQSTGSNSMAEVPGDLKPPTPASTPHGQMTPMQSGR RSSTVSVHDPFSDVSDSAYPKRNSMTPNAPYQQG

MGMPDMMGRMPYEPNKDPFSGMRKV - UNI12028 - VPGSSEPFMTQGQVPNSGMQDMYNQSPSGAMSNLGMGQRQQFPYGTSYDRR RHEAYGQQY

PGQGPPTGQPPYGGHQPGLYPQQP NYKRHMDGMYGPPAKRHEGDMYNMQYGSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYNRERMQGPGQMQPHGIPP

QMMGGPMQSSSSEGPQQNMWATRNDMPYPYQSRQGPGGPAQAPPYPGMNRTDDMMVPEQRINHESQWPSHVSQRQPYMSSSASMQPITRPPQSSYQTPPS

LPNHISRAPSPASFQRSLESRMSPSKSPFLPTMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPILKQRRKITSKDIV VTPEAWRVMMSL

KSGLLAESTWALDTINILLYDDSTVATFNLSQ LSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDHRSGKKDDSQSLEDDSGKEDDDAECLVEEE

EEEEEEEEDSEKIESEGKSSPALAAPDASVDPKETPKQASKFDKLPIKIVKKNKLFVVDRSDKLGRVQEFSSGLLHWQLGGGDTTEHIQTHFESKMEIPP

RRRPPPPLSSTGKKKELEGKGDSEEQPEKSIIATIDDVLSARPGALPEDTNPGPQTDSGKFPFGIQQAKSHRNIRLLEDEPRSRDETPLCTIAHWQDSLA

KRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTE

SICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGD

TLAARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNSLVASVICDV

LFQIGQL
Transcript ENSMUST00000077329
Sequence
AAGACAGTGAAAAGATAGAGTCAGAGGGGAAGAGCAGCCCTGCCCTAGCTGCTCCAGATGCCTCCGTGGACCCCAAGGAGACGCCAAAGCAGGCCAGTAA

GTTTGACAAGCTGCCCATAAAGATTGTCAAAAAGAACAAGCTGTTTGTGGTGGACCGGTCCGACAAGCTGGGCCGAGTGCAGGAGTTCAGCAGCGGGCTC

CTCCACTGGCAGCTGGGTGGTGGCGACACTACCGAGCACATCCAGACTCACTTCGAGAGCAAGATGGAGATCCCTCCTCGCAGGCGTCCACCTCCGCCTC

TAAGCTCCACGGGTAAGAAGAAAGAGCTGGAAGGCAAAGGTGATTCTGAAGAGCAGCCAGAGAAAAGTATCATAGCCACCATCGATGACGTCTTGTCTGC

CCGGCCAGGGGCTCTGCCTGAAGACACCAACCCAGGACCCCAGACCGACAGCGGCAAGTTTCCCTTTGGAATCCAGCAGGCCAAAAGCCACCGGAACATC

AGGCTCCTGGAAGACGAGCCCAGGAGCCGAGACGAGACGCCGCTGTGCACCATCGCGCACTGGCAGGACTCACTGGCCAAGCGCTGCATCTGTGTGTCGA

ACATCGTGCGGAGCTTGTCTTTCGTGCCTGGCAACGACGCAGAGATGTCCAAACACCCGGGCTTGGTGCTGATCCTGGGAAAGCTGATTCTGCTGCATCA

CGAGCATCCGGAGAGAAAGCGGGCGCCACAGACCTATGAGAAGGAGGAGGACGAGGACAAGGGGGTGGCCTGCAGCAAAGATGAGTGGTGGTGGGACTGC

CTCGAGGTCTTGCGGGATAACACCCTGGTCACGTTGGCGAACATTTCCGGGCAGCTAGACTTGTCTGCTTACACAGAGAGCATCTGCTTGCCGATCCTGG

ACGGCTTGCTACACTGGATGGTGTGCCCGTCCGCAGAGGCTCAGGACCCCTTTCCCACTGTGGGGCCCAACTCAGTCCTGTCGCCGCAGAGACTTGTGCT

GGAGACCCTGTGTAAACTCAGTATCCAGGACAACAACGTGGACCTGATCTTGGCCACGCCTCCATTTAGTCGTCAGGAGAAATTTTATGCTACATTAGTT

AGGTACGTTGGGGATCGCAAAAATCCAGTCTGTCGAGAAATGTCCATGGCGCTTTTATCGAACCTTGCCCAGGGGGACACACTGGCGGCGAGGGCAATAG

CTGTGCAGAAAGGAAGCATTGGTAACTTGATAAGCTTCCTAGAGGACGGGGTGACGATGGCGCAGTACCAGCAGAGCCAGCATAACCTTATGCACATGCA

GCCCCCACCTCTGGAACCCCCTAGTGTAGACATGATGTGCCGGGCGGCCAAAGCTCTGCTGGCCATGGCCAGAGTGGACGAGAACCGCTCGGAGTTCCTT

TTGCACGAGGGTCGGTTGCTGGATATCTCAATATCAGCTGTCCTGAACTCTCTGGTTGCATCTGTCATCTGTGATGTACTGTTTCAGATTGGGCAGTTAT

GACATCCGTGAAGGCACACATGTGTGAGTGAACATTAGAGGGTCACATATAACTGGCTGTTTTCTGTTCTCGTTTATCCAGTGTAAGAAGAAGGAAAAGA

AAAATCTTTGCTCCTCTGCCCCGTTTACTATTTACCAATTGGGAATTAAATCATTAATTTGAACAGTTATAAAATT
Translation
DSEKIESEGKSSPALAAPDASVDPKETPKQASKFDKLPIKIVKKNKLFVVDRSDKLGRVQEFSSGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPL

SSTGKKKELEGKGDSEEQPEKSIIATIDDVLSARPGALPEDTNPGPQTDSGKFPFGIQQAKSHRNIRLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSN

IVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILD

GLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDTLAARAIA

VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL
Transcript ENSMUST00000115797
Sequence
GACCTGTCTGGCTCCATCGATGACCTCCCCACGGGAACAGAAGCAACTCTGAGCTCAGCAGTCAGTGCATCCGGGTCTACAAGCAGCCAGGGAGATCAGA

GCAACCCAGCGCAGTCTCCTTTCTCCCCACATGCATCACCTCACCTCTCCAGCATCCCTGGAGGGCCGTCACCTTCTCCTGTTGGCTCTCCTGTGGGAAG

CAACCAATCGAGGTCTGGTCCGATCTCCCCTGCGAGTATTCCAG - UNI8432 - GTAGCCAGATGCCTCCGCAACCACCTGGAAGCCAGTCAGAATC

CAGTTCCCATCCTGCCTTGAGCCAGTCACCAATGCCACAGGAAAGAG GCACTCAGAGAAACCCTCAGATGTCTCAGTACGGACCTCAGCAGACAGGACC

ATCCATGTCGCCTCACCCATCTCCTGGGGGCCAGATGCATCCTGGGATCAGTAACTTTCAGCAGAGTAACTCAAGTGGCACGTACGGCCCACAGATGAGC

CAGTATGGACCCCAAG - UNI9953 - GCAACTACTCCAGAACCCCAACATATAGCGGGGTACCCAGTGCAAGCTACAGCGGCCCAGGGCCCGGTATG

GGCATCAATGCCAACAACCAGATGCATGGACAAGGGCCAGCCCAGCCATGTGGTGCTATGCCCCTGGGACGAATGCCTTCAGCTGGGATGCAGAACAGAC

CATTTCCTGGAACCATGAGCAGCGTCACCCCCAGTTCTCCTGGCATGTCTCAACAGGGAGGGCCAGGAATGGGCCCACCAATGCCCACTGTGAACCGGAA

GGCCCAGGAAGCTGCCGCAGCTGTGATGCAGGCTGCTGCAAACTCAGCACAAAGCAG - UNI9158 - GCAAGGCAGTTTTCCTGGCATGAACCAGAG

TGGCCTGGTGGCCTCCAGCTCTCCCTACAGCCAGTCCATGAACAACAACTCCAGCCTGATGAGCACCCAGGCCCAGCCCTACAGCATGACGCCCACAATG

GTGAACAGCTCCACAG - UNI12082 - CATCTATGGGTCTTGCAGATATGATGTCTCCCAGTGAGTCCAAATTGTCTGTGCCTCTTAAAGCAGATGG

TAAAGAAGAAGGCGTGTCCCAGCCTGAGAGCAAGTCAAAG GACAGCTATGGCTCTCAGGGCATTTCCCAGCCTCCAACCCCAGGCAACCTGCCTGTCCC

TTCCCCAATGTCTCCCAGCTCTGCCAGCATCTCCTCCTTTCATGGAGATGAGAGTGACAGCATTAGCAGCCCAGGCTGGCCCAAGACACCATCAAGCCCT

 AAGTCCAGCTCTTCCTCCACCACTGGGGAGAAGATCACGAAGGTCTATGAGCTGGGGAATGAGCCGGAGAGGAAGCTGTGGGTCGACCGTTACCTAACG

TTCATGGAAGAGAGGGGCTCCCCGGTGTCCAGTCTGCCAGCAGTGGGCAAGAAGCCCCTGGACCTGTTCCGACTGTATGTCTGCGTCAAGGAGATTGGAG

GTTTGGCGCAG - UNI9799 - GTTAATAAAAACAAGAAGTGGCGTGAGCTGGCAACCAACCTGAACGTTGGCACTTCCAGCAGCGCAGCCAGCTCTC

TGAAAAAGCAGTATATTCAGTACCTGTTCGCCTTTGAGTGCAAAACTGAGCGCGGGGAGGAGCCCCCACCTGAAGTCTTCAGCACCGGGGATTCGAAGAA

GCAGCCAAAGCTCCAGCCGCCATCTCCT
Translation
DLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPG - UNI8432 - GSQMP

PQPPGSQSESSSHPALSQSPMPQERG GTQRNPQMSQYGPQQTGPSMSPHPSPGGQMHPGISNFQQSNSSGTYGPQMSQYGPQG - UNI9953 - GNY

SRTPTYSGVPSASYSGPGPGMGINANNQMHGQGPAQPCGAMPLGRMPSAGMQNRPFPGTMSSVTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAA

ANSAQSR - UNI9158 - RQGSFPGMNQSGLVASSSPYSQSMNNNSSLMSTQAQPYSMTPTMVNSSTA - UNI12082 - ASMGLADMMSPSESKL

SVPLKADGKEEGVSQPESKSK DSYGSQGISQPPTPGNLPVPSPMSPSSASISSFHGDESDSISSPGWPKTPSSP KSSSSSTTGEKITKVYELGNEPER

KLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQ - UNI9799 - VNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKT

ERGEEPPPEVFSTGDSKKQPKLQPPSP
Transcript ENSMUST00000115798
Sequence
CGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATGGGCAGATCCCAG - UNI19911 - GGCAGCCCGATGGAC

CCAATGGTGATGAAGAGACCTCAGTTGTATGGGATGGGTACTCACCCCCACTCCCAGCCACAGCAGAGCAGCCCATACCCAGGAGGCTCCTACGGTCCCC

CAGGTGCACAGCGGTATCCCCTTGGCATGCAGGGCCGGGCTCCAGGGGCCCTGGGAGGCTTGCAGTACCCGCAGCAGCAG - UNI8682 - ATGCCAC

CGCAGTACGGACAGCAAGCTGTGAGTGGCTACTGCCAGCAAGGCCAGCAGCCATACTACAACCAGCAGCCGCAGCCCTCGCACCTCCCGCCCCAGGCACA

GTACCTGCAGCCGGCGGCGGCGCAGTCCCAGCAGAGGTACCAGCCACAGCAG - UNI2777 - GACATGTCTCAAGAAGGCTATGGAACTAGATCTCA

GCCTCCTCTGGCCCCTGGAAAATCCAACCATGAAGACTTGAATTTAATTCAACAGGAAAGACCATCGAGTCTACCA
Translation
MSPGTPGPTMGRSQ - UNI19911 - GSPMDPMVMKRPQLYGMGTHPHSQPQQSSPYPGGSYGPPGAQRYPLGMQGRAPGALGGLQYPQQQ - UNI8

682 - MPPQYGQQAVSGYCQQGQQPYYNQQPQPSHLPPQAQYLQPAAAQSQQRYQPQQ - UNI2777 - DMSQEGYGTRSQPPLAPGKSNHEDLNLI

QQERPSSLP
Transcript ENSMUST00000115799
Sequence
GCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATGGGCAGATCCCAG - UNI19911 - GGCAGCCCGATGGA

CCCAATGGTGATGAAGAGACCTCAGTTGTATGGGATGGGTACTCACCCCCACTCCCAGCCACAGCAGAGCAGCCCATACCCAGGAGGCTCCTACGGTCCC

CCAGGTGCACAGCGGTATCCCCTTGGCATGCAGGGCCGGGCTCCAGGGGCCCTGGGAGGCTTGCAGTACCCGCAGCAGCAG - UNI8682 - ATGCCA

CCGCAGTACGGACAGCAAGCTGTGAGTGGCTACTGCCAGCAAGGCCAGCAGCCATACTACAACCAGCAGCCGCAGCCCTCGCACCTCCCGCCCCAGGCAC

AGTACCTGCAGCCGGCGGCGGCGCAGTCCCAGCAGAGGTACCAGCCACAGCAG - UNI2777 - GACATGTCTCAAGAAGGCTATGGAACTAGATCTC

AGCCTCCTCTGGCCCCTGGAAAATCCAACCATGAAGACTTGAATTTAATTCAACAGGAAAGACCATCGAGTCTACCA - UNI2821 - GACCTGTCTG

GCTCCATCGATGACCTCCCCACGGGAACAGAAGCAACTCTGAGCTCAGCAGTCAGTGCATCCGGGTCTACAAGCAGCCAGGGAGATCAGAGCAACCCAGC

GCAGTCTCCTTTCTCCCCACATGCATCACCTCACCTCTCCAGCATCCCTGGAGGGCCGTCACCTTCTCCTGTTGGCTCTCCTGTGGGAAGCAACCAATCG

AGGTCTGGTCCGATCTCCCCTGCGAGTATTCCAG - UNI8432 - GTTTTATGACAGGCACTCAGAGAAACCCTCAGATGTCTCAGTACGGACCTCAG

CAGACAGGACCATCCATGTCGCCTCACCCATCTCCTGGGGGCCAGATGCATCCTGGGATCAGTAACTTTCAGCAGAGTAACTCAAGTGGCACGTACGGCC

CACAGATGAGCCAGTATGGACCCCAAG - UNI9953 - GCAACTACTCCAGAACCCCAACATATAGCGGGGTACCCAGTGCAAGCTACAGCGGCCCAG

GGCCCGGTATGGGCATCAATGCCAACAACCAGATGCATGGACAAGGGCCAGCCCAGCCATGTGGTGCTATGCCCCTGGGACGAATGCCTTCAGCTGGGAT

GCAGAACAGACCATTTCCTGGAACCATGAGCAGCGTCACCCCCAGTTCTCCTGGCATGTCTCAACAGGGAGGGCCAGGAATGGGCCCACCAATGCCCACT

GTGAACCGGAAGGCCCAGGAAGCTGCCGCAGCTGTGATGCAGGCTGCTGCAAACTCAGCACAAAGCAG - UNI9158 - GCAAGGCAGTTTTCCTGGC

ATGAACCAGAGTGGCCTGGTGGCCTCCAGCTCTCCCTACAGCCAGTCCATGAACAACAACTCCAGCCTGATGAGCACCCAGGCCCAGCCCTACAGCATGA

CGCCCACAATGGTGAACAGCTCCACAG - UNI12082 - CATCTATGGGTCTTGCAGATATGATGTCTCCCAGTGAGTCCAAATTGTCTGTGCCTCTT

AAAGCAGATGGTAAAGAAGAAGGCGTGTCCCAGCCTGAGAGCAAGTCAAAG GACAGCTATGGCTCTCAGGGCATTTCCCAGCCTCCAACCCCAGGCAAC

CTGCCTGTCCCTTCCCCAATGTCTCCCAGCTCTGCCAGCATCTCCTCCTTTCATGGAGATGAGAGTGACAGCATTAGCAGCCCAGGCTGGCCCAAGACAC

CATCAAGCCCT AAGTCCAGCTCTTCCTCCACCACTGGGGAGAAGATCACGAAGGTCTATGAGCTGGGGAATGAGCCGGAGAGGAAGCTGTGGGTCGACC

GTTACCTAACGTTCATGGAAGAGAGGGGCTCCCCGGTGTCCAGTCTGCCAGCAGTGGGCAAGAAGCCCCTGGACCTGTTCCGACTGTATGTCTGCGTCAA

GGAGATTGGAGGTTTGGCGCAG - UNI9799 - GTTAATAAAAACAAGAAGTGGCGTGAGCTGGCAACCAACCTGAACGTTGGCACTTCCAGCAGCGC

AGCCAGCTCTCTGAAAAAGCAGTATATTCAGTACCTGTTCGCCTTTGAGTGCAAAACTGAGCGCGGGGAGGAGCCCCCACCTGAAGTCTTCAGCACCGGG

GATTCGAAGAAGCAGCCAAAGCTCCAGCCGCCATCTCCTG - UNI18529 - CTAACTCAGGATCCTTACAAGGCCCACAGACTCCACAGTCAACTGG

GAGCAATTCGATGGCAGAGGTTCCAGGTGACCTGAAGCCACCAACCCCAGCCTCTACCCCTCATGGACAGATGACTCCCATGCAAAGCGGAAG AAGCAG

TACAGTCAGTGTGCATGACCCGTTCTCAGACGTGAGTGACTCAGCGTACCCAAAACGGAACTCCATGACTCCAAACGCCCCATACCAGCAGGGCATGGGC

ATGCCAGACATGATGGGCAGGATGCCCTATGAACCCAACAAGGACCCTTTCAGTGGAATGAGAAAAG - UNI12028 - TGCCTGGAAGTAGTGAGCC

CTTTATGACACAAGGACAGGTGCCCAACAGCGGCATGCAGGACATGTACAACCAGAGCCCCTCAGGGGCCATGTCCAATCTGGGCATGGGACAGCGGCAG

CAGTTTCCCTATGGAACCAGTTATGACCGAAG GCATGAGGCTTACGGACAGCAGTACCCAGGCCAAGGCCCTCCCACAGGACAGCCACCGTATGGAGGA

CACCAGCCTGGCCTGTACCCACAGCAGCCG AATTACAAACGTCATATGGATGGCATGTACGGGCCTCCAGCCAAGCGGCACGAGGGAGACATGTACAAC

ATGCAGTATGGCAGCCAGCAGCAGGAGATGTATAACCAGTATGGAGGCTCCTACTCTGGCCCGGACAGAAGGCCCATCCAGGGACAATATCCCTACCCCT

ACAACAGAGAAAGGATGCAGGGCCCAGGCCAGATGCAGCCACACGGAATCCCACCTCAGATGATGGGGGGCCCCATGCAGTCATCCTCCAGCGAGGGGCC

TCAGCAGAACATGTGGGCTACACGCAACGATATGCCTTATCCCTACCAGAGCAGGCAAGGCCCGGGCGGCCCTGCACAGGCCCCCCCTTACCCAGGCATG

AACCGCACAGATGATATGATGGTACCTGAGCAGAGGATCAATCACGAGAGCCAGTGGCCTTCTCACGTCAGCCAGCGCCAGCCTTACATGTCATCTTCGG

CCTCCATGCAGCCCATCACGCGCCCACCTCAGTCATCCTACCAGACGCCGCCGTCACTGCCAAACCACATCTCCAGGGCACCCAGCCCCGCCTCCTTCCA

GCGCTCCCTGGAGAGTCGCATGTCTCCAAGCAAGTCTCCCTTCCTGCCCACCATGAAGATGCAGAAGGTCATGCCCACAGTCCCCACATCCCAGGTCACC

GGGCCCCCCCCACAGCCTCCACCAATCAGAAGGGAGATTACCTTTCCTCCTGGCTCCGTAGAAGCATCACAGCCAATCCTGAAACAAAGGCGAAAGATTA

CCTCAAAAGATATTG TTACTCCCGAGGCGTGGCGTGTGATGATGTCCCTTAAATCGGGTCTGTTGGCTGAGAGCACGTGGGCTCTGGACACCATCAATA

TTCTCCTCTATGATGACAGCACCGTCGCCACCTTCAATCTTTCCCAG CTGTCTGGATTCCTGGAACTATTAGTAGAGTACTTTCGAAAATGCCTAATTG

ACATTTTCGGAATTCTTATGGAATATGAAGTGGGTGACCCCAGCCAAAAGGCTCTTGATCACCGTTCAGGGAAGAAAGATGACAGCCAGTCCCTGGAAGA

TGATTCTGGGAAGGAAGACGATGATGCTGAGTGTCTTGTGGAAGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGACAGTGAAAAGATAGAGTCAGAGGGG

AAGAGCAGCCCTGCCCTAGCTGCTCCAGATGCCTCCGTGGACCCCAAGGAGACGCCAAAGCAGGCCAGTAAGTTTGACAAGCTGCCCATAAAGATTGTCA

AAAAGAACAAGCTGTTTGTGGTGGACCGGTCCGACAAGCTGGGCCGAGTGCAGGAGTTCAGCAGCGGGCTCCTCCACTGGCAGCTGGGTGGTGGCGACAC

TACCGAGCACATCCAGACTCACTTCGAGAGCAAGATGGAGATCCCTCCTCGCAGGCGTCCACCTCCGCCTCTAAGCTCCACGGGTAAGAAGAAAGAGCTG

GAAGGCAAAGGTGATTCTGAAGAGCAGCCAGAGAAAAGTATCATAGCCACCATCGATGACGTCTTGTCTGCCCGGCCAGGGGCTCTGCCTGAAGACACCA

ACCCAGGACCCCAGACCGACAGCGGCAAGTTTCCCTTTGGAATCCAGCAGGCCAAAAGCCACCGGAACATCAGGCTCCTGGAAGACGAGCCCAGGAGCCG

AGACGAGACGCCGCTGTGCACCATCGCGCACTGGCAGGACTCACTGGCCAAGCGCTGCATCTGTGTGTCGAACATCGTGCGGAGCTTGTCTTTCGTGCCT

GGCAACGACGCAGAGATGTCCAAACACCCGGGCTTGGTGCTGATCCTGGGAAAGCTGATTCTGCTGCATCACGAGCATCCGGAGAGAAAGCGGGCGCCAC

AGACCTATGAGAAGGAGGAGGACGAGGACAAGGGGGTGGCCTGCAGCAAAGATGAGTGGTGGTGGGACTGCCTCGAGGTCTTGCGGGATAACACCCTGGT

CACGTTGGCGAACATTTCCGGGCAGCTAGACTTGTCTGCTTACACAGAGAGCATCTGCTTGCCGATCCTGGACGGCTTGCTACACTGGATGGTGTGCCCG

TCCGCAGAGGCTCAGGACCCCTTTCCCACTGTGGGGCCCAACTCAGTCCTGTCGCCGCAGAGACTTGTGCTGGAGACCCTGTGTAAACTCAGTATCCAGG

ACAACAACGTGGACCTGATCTTGGCCACGCCTCCATTTAGTCGTCAGGAGAAATTTTATGCTACATTAGTTAGGTACGTTGGGGATCGCAAAAATCCAGT

CTGTCGAGAAATGTCCATGGCGCTTTTATCGAACCTTGCCCAGGGGGACACACTGGCGGCGAGGGCAATAGCTGTGCAGAAAGGAAGCATTGGTAACTTG

ATAAGCTTCCTAGAGGACGGGGTGACGATGGCGCAGTACCAGCAGAGCCAGCATAACCTTATGCACATGCAGCCCCCACCTCTGGAACCCCCTAGTGTAG

ACATGATGTGCCGGGCGGCCAAAGCTCTGCTGGCCATGGCCAGAGTGGACGAGAACCGCTCGGAGTTCCTTTTGCACGAGGGTCGGTTGCTGGATATCTC

AATATCAGCTGTCCTGAACTCTCTGGTTGCATCTGTCATCTGTGATGTACTGTTTCAGATTGGGCAGTTATGACATCCGTGAAGGCACACATGTGTGAGT

GAACATTAGAGGGTCACATATAACTGGCTGTTTTCTGTTCTCGTTTATCCAGTGTAAGAAGAAGGAAAAGAAAAATCTTTGCTCCTCTGCCCCGTTTACT

ATTTACCAATTGGGAATTAAATCATTAATTTGAACAGTTATAAAATTAATATTTGCTGTCTGTGTGTATAAGTACATCCTCTGGCGGTTTTCTGTTTCTT

TTTTTTTTAACCAAAGTTGCCGTCTAGTGCATTCAAAGGTCACAATTTTTGTTTGTTTGTTTGTTTGTTTGTTTTTTCATAATTTTTTTCATGTTGTATT

GCAGTCTTTGGGAAGTGAATTGACTTTATAAAGAAAAACGTTTTGGCAAAAAGTGCTAAGATAGAAAAATGTCACCACACTGGGTCAAAAACGTGAAAGG

AAAAATTGATTCTTAAATTGATTTCCTATGAATTTTATTCTTCACAGAATGATAAAAGCTAAACTGCACCCCGTCACCCAAAGCTCTGTGCAATAGAAAC

TTCTAGAGATATAGTGTAGGGGCTGAAGGAGGTATGGCAGCAGTAGTCAGGGTCAATGATACTGCTTTCTCCACCGGAAAGTGGTTACGTTAGGCCTCGA

GCAAAAAACAGCGCTCTCAGATAGGTGCAAAAATCCACTCCTAGCAGCCAACAGCAGGATCGCTTCCTCACCACGACCGCCATGTCTGCTGTGGCTCAGC

CTCCACGGGACAAAGCTTCAAGATTTCTTTCATCATTTTTTTAAATATTTTTTTTACTGCCTATGGGCTGTGATGTATATAGAAGTTGTACATTAAACAT

ACCCTCATTTTTTTCTTCTTTTCTTTTTTTCTTTTTTTCTTTTTCTTTTTTTTTTTTTTTAGTACAAAGTTTTTAGTTTCTTTTTCATGATGTGGTAACT

ACGAAGTGATGGTAGATTTAAATAATTTTTTATTTTTATTTTATATATTTTTTCATTAGGACCATATCTCCAAAAAACAAGAAAAAGAAACAAAAAATAC

AAAAAATAAAAACAAACAAAAAAAGAGGGTAATGTACAAGTTTCTGTATGTATAAAGTCATGCTCTGTTGGGAGAGCGGCTGATCCCAGTTTGCTTCATG

AATCAAAGTGTGGAAATGGTTGCATACAGATTGATTTAGAAAATGGACACCAGTACATACAAAAAAAGAAAAAAGAAAGAAAACCAACTAAATGGAAGAA

ACACAACTTCAAAGATTTTTCTGTGACAAGAATCCACATTTGTATTTCAAGATAATGTAGTTTAAGAAAAGAAAAAAAAGAAAAAAAAAGAAAAAAACTT

GATGTAAATTCCTCCTTTTCCTCTGGCTTAATGAATATCATTTATTCAGTATAAAATCTTTATATGTCCCACATGTTAAGAATAAATGTACATTAAATCT

TGTTACGCACTGTGATGGGTGTTCTTGAATGCTGTTCTAGTTTGCCTAGCATGGTTGCCATAGTAACCAAGTTATTTACAGGAAATAGGGAAGATGTAAC

AACTGCTTCCTGGTAATGATGCCCAAAGGCCAGAAGGGACTTTCAGGGTTTCCTACTTGAGAGTGGGAGCAACAATTTGATTTTCTCAGATTGTTTAGCT

AATTAGGTCTTCTTTGAAGCAATTAACTCTGGTGACATTGAGAAGTGGTAATTCCCTCATGGATGGGTGGTGGCTGCCAACCCACTGTGACATGGGGCCC

TGCAAGCTAACTGGCCTGAAACCACGACCTTCTGCCTCTCACTACTGATTTAACCCAAGTCTGCACCCGTCATGTTTCTTCTGTGTGCCTCCAAGTTACT

CTGCGTTAGTTTGCTCCAGCGTGTATAATATTTATATTGTGCAATGTTAAAGAGAACGTGTCATATTGTATGCCGTGTGTATAGTGCCAAGTGATGATTC

TGTTTCAGAGCATACCTTCCTTCCTGCCCAGTCCCTGGCTCTCTAATACCCCACCCTGATGGAAAGTGCTTCTTCCTGGGTAATTGACTGTTACTGTGTA

ACGCTCAGTCTCATTGAAACTTACATAACCATGCTGCTGGTGCCCCTTCCTACCCTACCTCTCTCAGCACTCTTCAGTTGACACTTCCCACACCTGTCAC

TGTGGCCCACCTTGCTCACGCTGACATCTGGAAGAGTTAGACAGGAGCACACACTTACAACACTAGGAGATGTTATTCTGGTGTCACGAGAAAGAAATTG

GTTTTTCCTGCAAACAGTCCCATCACCAAGCAGCCCCCACATCAGGTCAGCAAAAAGATCTGTGTTGAATCAAAACTCCATTTATAATTCTACTAGATGG

GAATACATCTGCTTACAAAGGACAGATTTTAGTGTTCTGTGATGAAAATATGGAGAGTGCAAGAGAGAGTTCAATGGAATCCTAATCTTGCTCTTGCAGA

CAATGAATGAAAGGTATAGACAGGCTCAGTTCCCTGTCAGAAGAGTGGTCTCAAAGACAAGTGGCTGTATAGCAGCCAGGCCCAGAACAGCCTCGCAGCA

CACACTAACACCAAGCGGGTGTCTGAGCTCTCCTAGGAAGCCTTGTGCCTGCCCTCCCTCCATTCACCCAGATCCGACTCCTGGAAGCCCACGAAAGAGT

CACCCTTTGCTTCACATTTCCTGACGATACCGAGTTGCTGCTCTGTCCTAAAAATATTAGTTCTTTTCCAGGGCTTTCAGAAATTTGCAGGATGCCCATA

CTCTAAATGTGTACCAAAAAGAGAGAGAAATAAAGGTGCGAAGAAAGTTTAGTATTTTGGAATGGTGCGATAAAATGGAATCTGTTGGTTTTTAATGTAA

CATAAGATACTATTGGCTGGCACTGGCTAAAAAAAATATCTAAGTGTTGGAGTTGGATGCACAATCAACTTTTACTTAGCTATTCAAAGAGTACTTATGT

TTTCCAAGTTAAAACAGACTTGTTTTTGACAGGGGCCGTGGGTGGTCTTATACAATGCCAGCTCCTAACTGCAGCTTCTGAGAACTGGATATCGTTTGCC

CTGAGAGCTGCCCGTCTCCAACTATGTGCTGCTGCTGCCCTGTGTGCTCAGCCCACAAGGATGTGGAGACTGGATAGACAACCCCTTGCTTCTTGCTGGG

TTGTGCTGAGTTCTTTGCAGTCCAGTCAAGTGCCCAGAGCTACCAGCCTACGTCCCTCATGCATCCAAGAGAAATGATCTTGACTATCATGATCAAAACA

GCTGTAGTAATATTTCTAGTAAATATTTCTGATGACTCTGTGTAATCTCCTACAACAGGACACTATTCATTAACTTGACAGAGACATGTGGGCATGTGGT

CCTGCTTTAGTTTAACAGACAAGTCAACCAGTTCTCATTACTTAGGAAGAGTGAGGCTATGTCTGTTACAATCCCAATGTGGTGCTTGCCCTTATCCAAA

GACAGTCCGGGGGCCCTGTCTGCCTGAACTATGTCTCGCTCCCTCTTGGGCTTCCCACTGGGATGTGAAAAGATAACCAATGGCTCCCAGGTTCCCAGTG

CCCCCCAAACCAGTAATCAGGTCTGGGACTACAGAACCCGCAAAATCATACACAGGCTGTTTCAAAGCCAGTACTCTCTTTATACTCCTGCTTCCTCCAG

CCCCCATTTCACACCCCACCCAAATCACAAGGTCCTCTGAAGTCTCAGAACTCCAAATTAACGTTGGGATTTACGATGTGAATGCTGAGGAGAAAATTGG

GAGTTGGTGGGAGATCACCAAATTGTCAAAACTATGAAACTCATCTGTCTTCCCAAATCTGACCTCAGGGACTTGGGGGGTTCACTCTGGCTTCTGCCAC

AGTATTTTCTGGGGAACCAAAGGCCTCGGGAATAGAGAAACAGGTTGCCGGATATCCTGGAAGTCTAAGCCATACTGACCAGTTTGTCTTGAGTGTTTTC

TTTGTGAGCCTGGAACTGTCCCCGGACCCCTTTCTTTTAAACATGGTTCAGGACTTTAAAAAAAAGCACTGTATTTTTTTTATGTAAGCCAAGATGCCCT

CCCTAGCAGAGATAGCGTTGAACTGTCTCTAGTTCTGTAGCCTGAGAGACTTAAATCGTTTAACTTCAGTGTCTTTGTCCACTCTGTTGAACTGCTAAGG

ATTCTATTGAATGTGTTCTTTGCGGCTTTGGAGGAGTTGCTGGGTGTGTAAGTCCTGCATCCCTTTGCCTGGTATGTGTATATTATTCCTTTGCCTGGCT

GTGTATCGTTCTTCAGTGTAAGTACACCCACACTCTGTATTCCTTTGCCTGCTCCCCGCCCCCCCACACACACACATCCTGCATAGTTTTAAAATAAGGC

CTGAGAGACTGTTTCTATTTCCTGTCATAGCTGGTGACTTTTAACAGTTGAGGCGAATGGCCTGTCACTTGCCTGGGTTCCCGTCAGGGGTGATCCATGG

AACTCCTCAGTGGAACAGAATTTAGGACAGAAGATCCCACCTTCCTTCCAGGCCTGGGGAGAATCAGACTGTGAGATAAACCATGATGCTGCCCAATCCC

ACTGCCCCACCTTGCTTTTAAAATAAAGTGCCTCCTAACGTC
Translation
MSPGTPGPTMGRSQ - UNI19911 - GSPMDPMVMKRPQLYGMGTHPHSQPQQSSPYPGGSYGPPGAQRYPLGMQGRAPGALGGLQYPQQQ - UNI8

682 - MPPQYGQQAVSGYCQQGQQPYYNQQPQPSHLPPQAQYLQPAAAQSQQRYQPQQ - UNI2777 - DMSQEGYGTRSQPPLAPGKSNHEDLNLI

QQERPSSLP - UNI2821 - DLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPA

SIPG - UNI8432 - GFMTGTQRNPQMSQYGPQQTGPSMSPHPSPGGQMHPGISNFQQSNSSGTYGPQMSQYGPQG - UNI9953 - GNYSRTPTY

SGVPSASYSGPGPGMGINANNQMHGQGPAQPCGAMPLGRMPSAGMQNRPFPGTMSSVTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQS

R - UNI9158 - RQGSFPGMNQSGLVASSSPYSQSMNNNSSLMSTQAQPYSMTPTMVNSSTA - UNI12082 - ASMGLADMMSPSESKLSVPLKA

DGKEEGVSQPESKSK DSYGSQGISQPPTPGNLPVPSPMSPSSASISSFHGDESDSISSPGWPKTPSSP KSSSSSTTGEKITKVYELGNEPERKLWVDR

YLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQ - UNI9799 - VNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEP

PPEVFSTGDSKKQPKLQPPSPA - UNI18529 - ANSGSLQGPQTPQSTGSNSMAEVPGDLKPPTPASTPHGQMTPMQSGR RSSTVSVHDPFSDVSD

SAYPKRNSMTPNAPYQQGMGMPDMMGRMPYEPNKDPFSGMRKV - UNI12028 - VPGSSEPFMTQGQVPNSGMQDMYNQSPSGAMSNLGMGQRQQFP

YGTSYDRR RHEAYGQQYPGQGPPTGQPPYGGHQPGLYPQQP NYKRHMDGMYGPPAKRHEGDMYNMQYGSQQQEMYNQYGGSYSGPDRRPIQGQYPYPY

NRERMQGPGQMQPHGIPPQMMGGPMQSSSSEGPQQNMWATRNDMPYPYQSRQGPGGPAQAPPYPGMNRTDDMMVPEQRINHESQWPSHVSQRQPYMSSSA

SMQPITRPPQSSYQTPPSLPNHISRAPSPASFQRSLESRMSPSKSPFLPTMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPILKQRRKIT

SKDIV VTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQ LSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDHRSGKKDDSQSL

EDDSGKEDDDAECLVEEEEEEEEEEEDSEKIESEGKSSPALAAPDASVDPKETPKQASKFDKLPIKIVKKNKLFVVDRSDKLGRVQEFSSGLLHWQLGGG

DTTEHIQTHFESKMEIPPRRRPPPPLSSTGKKKELEGKGDSEEQPEKSIIATIDDVLSARPGALPEDTNPGPQTDSGKFPFGIQQAKSHRNIRLLEDEPR

SRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNT

LVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKN

PVCREMSMALLSNLAQGDTLAARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLD

ISISAVLNSLVASVICDVLFQIGQL

For any suggestions or comments, please send an email to unitrap@crg.es