Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069814 (E130309D14Rik)
Chromosomal location
Chr 11: 74433107 - 74455018 (+)
Description
RIKEN cDNA E130309D14 gene Gene [Source:MGI Symbol;Acc:MGI:3588240]
RefSeq_dna
NM_001013784 
RefSeq_peptide
NP_001013806.1 
MGI
MGI:3588240 
Uniprot/SPTREMBL
Q5SUE3 
Human Ortholog
not available
Omim not available
UniTrap UNI20164
Vector Insertion
Chr 11: 74433349 - 74443460
Public Clones IST14957F5 (tigm) IST14575G5 (tigm) IST14126E6 (tigm) IST14494D2 (tigm)
IST10994C3 (tigm)
Private Clones OST370410 (lexicon) OST357205 (lexicon) OST312941 (lexicon) OST288430 (lexicon)
OST278079 (lexicon) OST275725 (lexicon) OST274192 (lexicon) OST250687 (lexicon)
OST250201 (lexicon) OST249857 (lexicon) OST246562 (lexicon) OST245218 (lexicon)
OST245193 (lexicon) OST179267 (lexicon) OST175209 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23763
Vector Insertion
Chr 11: 74443614 - 74448742
Public Clones not available
Private Clones OST245715 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35974
Vector Insertion
Chr 11: 74448926 - 74449403
Public Clones IST11842H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22908
Vector Insertion
Chr 11: 74451340 - 74451586
Public Clones not available
Private Clones OST281497 (lexicon) OST255012 (lexicon) OST245467 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092916
Sequence
GTTCGCCAGTTCCGGTCACGTTGCTGGGTGTTTACGCCCGAAGCCTGCCCTAGGCCCCCCACCTCTGCGCCCCGGAGCCCCCCAGAGCCCTGGAGTCCGC

ACCCCACAGCCTCGCAGCAGTTGATGGCGCCGCAGCCGGGCCGCGCTCTGCGGATCCATGAGCGCAGCTAGCGCGGGAGAAGAGCTCTTCCAGAGACCCA

GCGAGGCCCGGGCCGGGCCCGGCGGCTCTCTCGGGTCCGCAG - UNI20164 - GTGGGGCCCAGGCCTGGGTTGCCATGGATACCGTGTCCCTGGAG

CATCAGATCCAGAGCGTGCAACGCCACATCAGCTTCCTGAAAAAGGAGCAGATGGCCCTGCTTCGAGACCTGCACCTGGAGATCCTGAGGCTGCAGAAAC

GCTGCTCAG - UNI23763 - AGCTGACCCACGACCTGGAGATGAGAGAGGTCCAGTCTCACCAACAAG GTAAGTACACTGTAGCTGTCTTCAGACA

CTCCAGAAGAAGG - UNI35974 - ATTTTTAAGTCTCACTTGGGCCGGGCAT TATATCCGGGGCTACATAAAAGACCCTGTCTCAAAAC TGAAGT

CATTGTTTCAGGAGGGAGGAGGGAA CTTTCCTCTG GGTATAGATGGGGAG GATTATTTACTACGCTGCGCC - UNI22908 - CTGCAGCCTGCG

CTCGGAGGAGCGCCGCTTTCTGGAGGAGCTGCGGCGCCGCAGCCATCGCGCCACGGTGCTGGGCACCGAGCTGCAGAAGCACACCGAAGCGGCCGCCTAC

CTCTCCTGCCAGCTGCACGCCGCGCGCCAGAGACTGCAGGGCCCCCGCTCTGGCGCCGCGGCCGCGGAGCCCCGGGTCCGCCGGCGTGCACAACGGGCCC

GCCGCCCTCCGGAGGCGGCTGCCAAGGGTCCGAGCCGGGACTGGGCGACCTGGGAAGACGCCGATCCCATGCCGGACCCCGCGCTCTTTCTCTACCCACG

GAGGCCGCCGCGGCCCGGCGCCCGTGGTCCTCGCCCTCTGCTACGCCAGGAGATGCCGGACCAAGATGCCCCGCACCCCGTGCCACACCAGGAGCCCCTG

TACCAAGGCGACCCGCACCCTGGGCCCAGCGAGAGCGCAGTCGCCACGCCCAGCGCCCCAGGGGATCCTGAGTAGGCGCTGGGCAGGCCTTGGCAACAGG

GAAAGCAGGCCGGGCCAGGCTGGATCAGGGATGGGGCGGAGTCCAGCCGGCCGATCCGCCCCAGCTCGGCCACTCACTAGAGCCGCCCCCGCTTGTGTGT

TTCCAGAGATGAATTGTCTTCTCCGGAGAGGGAGCTCCTTTGCAGAGGGAACGCCAAAGCAATGCACCTTTTTTGTGGTGGACTGGCAGTAA
Translation
MSAASAGEELFQRPSEARAGPGGSLGSAG - UNI20164 - GGAQAWVAMDTVSLEHQIQSVQRHISFLKKEQMALLRDLHLEILRLQKRCSE - UN

I23763 - ELTHDLEMREVQSHQQG GKYTVAVFRHSRRR - UNI35974 - IFKSHLGRAL LYPGLHKRPCLKT TEVIVSGGRRE LSSG GYR

WGG GLFTTLRP - UNI22908 - PAACARRSAAFWRSCGAAAIAPRCWAPSCRSTPKRPPTSPASCTPRARDCRAPALAPRPRSPGSAGVHNGPAAL

RRRLPRVRAGTGRPGKTPIPCRTPRSFSTHGGRRGPAPVVLALCYARRCRTKMPRTPCHTRSPCTKATRTLGPARAQSPRPAPQGILSRRWAGLGNRESR

PGQAGSGMGRSPAGRSAPARPLTRAAPACVFPEMNCLLRRGSSFAEGTPKQCTFFVVDWQ
Transcript ENSMUST00000100866
Sequence
GTTCGCCAGTTCCGGTCACGTTGCTGGGTGTTTACGCCCGAAGCCTGCCCTAGGCCCCCCACCTCTGCGCCCCGGAGCCCCCCAGAGCCCTGGAGTCCGC

ACCCCACAGCCTCGCAGCAGTTGATGGCGCCGCAGCCGGGCCGCGCTCTGCGGATCCATGAGCGCAGCTAGCGCGGGAGAAGAGCTCTTCCAGAGACCCA

GCGAGGCCCGGGCCGGGCCCGGCGGCTCTCTCGGGTCCGCAG - UNI20164 - GTGGGGCCCAGGCCTGGGTTGCCATGGATACCGTGTCCCTGGAG

CATCAGATCCAGAGCGTGCAACGCCACATCAGCTTCCTGAAAAAGGAGCAGATGGCCCTGCTTCGAGACCTGCACCTGGAGATCCTGAGGCTGCAGAAAC

GCTGCTCAG - UNI23763 - AGCTGACCCACGACCTGGAGATGAGAGAGGTCCAGTCTCACCAACAAG - UNI22908 - - UNI35974 - AA

GAGGCGTCCCGAGAGCTGGAGGACAAGTGCCGCGCGCTAGAGTCGCAGCTGGAGGCACGGGCGGCGGCCAACGAGGAGCTGCGGCGGGAGGTGGCACAGC

GGGAGGCGCTGGTGTCCGCGCTGCGCTGCAGCCTGCGCTCGGAGGAGCGCCGCTTTCTGGAGGAGCTGCGGCGCCGCAGCCATCGCGCCACGGTGCTGGG

CACCGAGCTGCAGAAGCACACCGAAGCGGCCGCCTACCTCTCCTGCCAGCTGCACGCCGCGCGCCAGAGACTGCAGGGCCCCCGCTCTGGCGCCGCGGCC

GCGGAGCCCCGGGTCCGCCGGCGTGCACAACGGGCCCGCCGCCCTCCGGAGGCGGCTGCCAAGGGTCCGAGCCGGGACTGGGCGACCTGGGAAGACGCCG

ATCCCATGCCGGACCCCGCGCTCTTTCTCTACCCACGGAGGCCGCCGCGGCCCGGCGCCCGTGGTCCTCGCCCTCTGCTACGCCAGGAGATGCCGGACCA

AGATGCCCCGCACCCCGTGCCACACCAGGAGCCCCTGTACCAAGGCGACCCGCACCCTGGGCCCAGCGAGAGCGCAGTCGCCACGCCCAGCGCCCCAGGG

GATCCTGAGTAGGCGCTGGGCAGGCCTTGGCAACAGGGAAAGCAGGCCGGGCCAGGCTGGATCAGGGATGGGGCGGAGTCCAGCCGGCCGATCCGCCCCA

GCTCGGCCACTCACTAGAGCCGCCCCCGCTTGTGTGTTTCCAGAGATGAATTGTCTTCTCCGGAGAGGGAGCTCCTTTGCAGAGGGAACGCCAAAGCAAT

GCACCTTTTTTGTGGTGGACTGGCAGTAATGACCCTAATCTGTGTGTGTGTGTGTCCCCACTCCCCTGCGGGGGGTGGAGTGGAGTCCTGTCTGTCCTTG

GAAAGCTGACAATCCCTTGTAGGGCGGGAGAAGTCTAAGTCTGCCTACTGGAAGGAACACGGTGGCACTTGGCACTGCTAGGCCCTCAAGCTCCCCTTCC

CTGCTTTCTCCACCTCCCACTACCCCCCACCCCCCAGCCCTGCCCAGCCTTTTGCTCGGGAGAGGCAAGCTTAGGAGCTGGCTCGCGTACTCAGAAGTAG

CTACTCCCCACCCCACTGATAAGTCCTTGAAGGTGAGCACGGAACACTTTAGAATCTATTTTAGAAGTCACGCCCTCTCAGAGCTGAGGTGTTCCTGGTG

GCAGTGATTACAGAGAACAGCAAGGCTAGACCCTTGAAGCCAGTCGTGGAAGAGGACCTGATTGGTTCTTCCCAGGTTTGTCATGCAGGGGTGCAGGAGA

TTGGAGATAGGCAAGCTGGGGCACAGATTTGTCTTGGCAAGGGTAGAAGGGCCTCTTACCCTTCTGTTCCTGAGGCCACCTTAGAGACTTCCCAGTCCTG

TTAGAGGTGCTAATCTTGCCCAGCTTTCCAAACAGCTGGCTGCACCCAGAGGCAGGAAGGAGAGCCCGGCTTCTTGGAAGTGGCAGCTATTCATAGAAAC

TTGATTTTTCTGGGGAACAAAGTAAAGTGGTTAGTCCTTGGTGGTACCCATCCCTGGAAAGGCCCCTAAGCCTGTAGAACCTGCTGATAATGGGGTGCTC

CTCTGCTGTTGGGAGTGGTAAACAGAATGGTGACCCCTTCCCCTTCCCAATTCCCCTCACTACCAAAGGCAGGAAGCTTCTGTCCAGCTCATGATTGAGC

CCCATATCAGAGCCCCAGAACCCCACTCCACCACTCTTGGTTTGACCTGCTTTGAGTCCTAAGTGCCTGTGAGGTCTTTCCTGGGGCTGCTGAGAGAAGT

TGCCTCTCTTCACTCAGACACTGGACCCCTAGCAGGTCCTGGCCCTGGCTGAGGTACCACATTTGTGTGTGTCACCCAAGCCTTGAGGTGAGCAGTATGT

CTCTGTAGCTGACTTCTTCAGTCATGGCCACCGGGAAGAAAAAGAAATCCTGACTCATGTCCTCCACTTTGTAAGAGGAAGCAGGAATTTGGCAGGAAGC

AAAAGACAGTGAGCACACTCTAACCTGATCCTGCACACAGACCCCTCCCCTGAAGGGCAGCTGAGGCCATTGAGCAGTAGCTAGGCCTGGGCTGACCTGT

CTAGCTTTTGAGAGCTGGATGGTAGAAGCAGATCCCCTGGGGTCCCTACTAGGGCTCCAACCTCTACCCCTTCAGCCCAGCTGCAATACCTGTCCCACCT

GTCACTCCCTGCTCTGTCCACCGGGAACCTGCCTGTGTGAGGGACTCCTGCTCCCTTGGAGGTGCCTGAAGGACAATAGGAAAGGAAAGCTTCCTTCTTG

GGTCACCTGCACAGACCTACATCTCTTGCAAACCATATTTTTGGGGTGAACAGGGTGACTTTGTTAGGTTGACTTTTCTAGGGAGAGAGCTCTTTTCTTA

TCCATCCACCCACTAAAAGCCATAGTTATCCCCAACTAGTTTCCCTTAAACTATAGCAATAGCCCTCTTCCTTTTCTCTTCTGGGCACCCAGGGTGTTCA

GCTGGCTCTATCCAACCCCATCCCCAGGATCAGACAGTAGTACTCTGCCTCCCTTTCCTCAAATGACCCTGTCGTACCTCCCAAATCCTGTTCCTCGGCT

GACAGCGGAGATAATGATATCTGTTTGTGAGGTGTTTGAAGAGCTTCCAGATGAAAGGGTCTAAGGGCATCTGGGTACCAGTGGAGATCCTGGGGTGGGA

GTTGGATAATGCAACTCTTCCACAAGTGAGAGAGTGACAGAAAGGCCTGGTCAGACACAGGATTCTGGTGTTAGCAGAATACCCTTTCCCTCTTGTGGAA

ATAATGAAAGATTCCCTTCATTGGTCAACAGGCGAGGACTCCCTCAGGCTCTCGCCCTGGGACAGGACCTGCCCTTCACTTCCACCTCTTCCCTTCCTAG

ATATTGGCTATAGGAATCCACCTACTGGAAGGAAAAGTCCCAGCCACAGCCCAGGAATGACTCGGTGGCCAAGAAGGGAAAGGGCTGTTTCTCTTGGTTG

TACACATCCCCAGGGAGAGACTGAGAAGGTTCACGTGGACACTCAGGGTTCTTAGGGGAGAGTCCCACAGTGCAAGTGTAGACAGACCCGGAAGGAAGAA

CTGCAATGGAGTCCTACATTCTAGAAGCCACCCAGGGACAAGTGAGCAATGCAGCTCAAGGTTCTGCACCCTCATCACTATATCCTCGCCAAGGCAACCT

GTTCTCTGGGGGACCAGTTCTGGGGCCAAGATGGGGAAGCCCATCCCTATACAAGCAGCAGGATAGAGTCATCCTGGATGGAGGTGGAAGGGAAGGAGGC

CAGAGGGTGTGAAGCGTCTTATCATTTGGGAGCCAGGGTCTCCTGAGCACCCTTTCACACTGACGTGCCAGCCTTGAGTGGGAGACATACAGGGCAGTCA

GATCCTGCTCCAAATTCTCTGTTGGCTGCGCTTTTTAATCCAATGCTTTTTCAGAGTGTATTCACTCACCTACAGAAATAGAGCCCTGTGCTTTAGGGGT

GACTGTCATATGCCTTATTCTTAATAAAATGTTTGGAAAACATGGAGTCCATTCTCA
Translation
MSAASAGEELFQRPSEARAGPGGSLGSAG - UNI20164 - GGAQAWVAMDTVSLEHQIQSVQRHISFLKKEQMALLRDLHLEILRLQKRCSE - UN

I23763 - ELTHDLEMREVQSHQQE - UNI22908 - - UNI35974 - EEASRELEDKCRALESQLEARAAANEELRREVAQREALVSALRCSLR

SEERRFLEELRRRSHRATVLGTELQKHTEAAAYLSCQLHAARQRLQGPRSGAAAAEPRVRRRAQRARRPPEAAAKGPSRDWATWEDADPMPDPALFLYPR

RPPRPGARGPRPLLRQEMPDQDAPHPVPHQEPLYQGDPHPGPSESAVATPSAPGDPE

For any suggestions or comments, please send an email to unitrap@crg.es