Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070002 (Ell)
Chromosomal location
Chr 8: 73063604 - 73116755 (+)
Description
elongation factor RNA polymerase II Gene [Source:MGI Symbol;Acc:MGI:109377]
RefSeq_dna
NM_007924 
RefSeq_peptide
NP_031950.2 
UniGene
Mm.271973 
MGI
MGI:109377 
Uniprot/SWISSPROT
O08856 
Uniprot/SPTREMBL
Q3TXY9 
Human Ortholog
ENSG00000105656 (ELL)
Omim not available
UniTrap UNI3327
Vector Insertion
Chr 8: 73063741 - 73096761
Public Clones AL0041 (sanger) AC0486 (sanger) AW0369 (sanger) AS0990 (sanger)
AM0479 (sanger) AC0478 (sanger) AF0602 (sanger) AF0601 (sanger)
AS0166 (sanger) XR0863 (sanger) RRO223 (baygenomics) RRO240 (baygenomics)
RRS297 (baygenomics) RRO231 (baygenomics) RRO327 (baygenomics) RRJ538 (baygenomics)
RRO232 (baygenomics) RRS092 (baygenomics) XL961 (baygenomics) IST11570F12 (tigm)
IST15072H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2615
Vector Insertion
Chr 8: 73096810 - 73102735
Public Clones XR0772 (sanger) IST12559B11BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25758
Vector Insertion
Chr 8: 73103156 - 73105453
Public Clones IST14026B4 (tigm) IST12513A9 (tigm)
Private Clones OST167415 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14809
Vector Insertion
Chr 8: 73109928 - 73114418
Public Clones PST14354-NR (escells) PST2517-NR (escells) PST0019-NR (escells) PSTVU01.O9 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093454
Sequence
AGATGGCGGCGCTGAAGGAGGCTAGGAGTTACGGGTTGTCGTGTGGGCGCGTGAGCGACGGCAGCAGGGTGTCGGTGTTCCACGTGAAGCTCACCGACAG

TGCTTTGAAGGCTTTTGAAAGCTACCGGGCCCACCAG - UNI3327 - GATTCTGTGTCACTGAGACCTTCCATCCGATTTGAAGGAAGCCAAGGG -

 UNI2615 - CACATCTCTATACCCCAGCCTGACTGCCCAGAGGAGGTGCGGGCCTTCTCCTTCTACCTCTCCAATATTGGCCGCGACAGCCCTCAGGG

CAGCTTTGATTGCATCCAACAATATGTATCCAG CTATGGGGATGTACACCTGGACTGCCTGGGCAGCATCCAGGACAAGGTCACGGTGTGTGCTACTGA

TGACTCCTACCAGAAAGCACGACAGAGCATGGCACAGGCAGAGGAGGAGACTCGGAGCCGAAGTGCCATCGTCATTAAGGCTGGAGGCCGATACATGG -

 UNI25758 - GGAAAAAGGTTCAGTTTCGGAAGCCAGCGCCAGGGGCAGCTGATGCAGTACCCTCCCGGAAGCGTGCTACCCCCATTAACCTGGCAAG

TGCCATCAGAAAGAGCAGTGGGAGTGGAGCCAGCAGTGTGGTACAGAGGCCCTTCCGAGATCGGGTGCTACACCTCCTGGCCCTGAGGCCCTACAGGAAG

GCTGAGCTGCTGCTGCGGTTGCAGAAGGATGGGTTGACACAGGCAGACAAGGACACCCTGGACAGCCTGCTGCAGCAG GTGGCCAGTGTGAACCCCAAG

GATGGCACGTGCACGCTGCAGGACTGCATGTACAAAAGCCTGCAGAAGGACTGGCCCGGCTACTCTGAGGGGGACCGGCAGCTGCTGAAGCGCATGCTCA

TGCG GAAGCTGTGTCAGCCACAGAATGCCACTACAGACTCCAGCCCGCCCCGAGAGCATGGACGCTCTGCCTCACCCTCTCAG AAACGGCCTACAGAC

TTCATTGACCCCCTGGCCAGCAAGAAGCCCCGGATCTCACATTTCACACAGCGAGCACAACCCACCCTCAATGGCAAACTGGGTGCCCCCAATGGCCATG

AGACACTGCTGCCTGCTCCAGGACCCACCCCATCAGACACCCTCAGCTCTAGCCATCTGCCCCCACGGCTGGAGCCCCCAAGGACCCACGACCCCCTAGC

TGATGTCAGTAATGACCTAGGTCACAGTACCCAGGACTACAAGCACCAGGAAGCCACCCCAGCTCCAGCACCCCATCTTGGTCTTCCCCTGCTGACGGAC

TTTCCTCAGGCTGAGCAACCTACTAGCTCCTCACACACCCACAGCCGACCCAAGAAGAAGTCCAAGAAGCACAAAGACAAGGAGCGGCCCCCTGAAGAAA

GGCCCCCCGCCCCACAGCCTGATGCACCTACTGCCCCTGCACTACCGCCAGATGCCCCAG - UNI14809 - GTCTGAATGGAGCCTGTGACAATGAA

CCCACATCCTCGTCAGAGACCCCGGACTATTTGCT GAAATACCCAGCCATCTCGTCGTCAGAGCAGCGTCAGAGCTACAAGAATGACTTCAATGCTGAG

TACAGCGAGTACCGCAGTCTGCACGCGCGGATCGAGCAGATCACCCGCAGGTTCACCCAGCTTGACGCACAGCTCAGACAGCTGAGCCAGGGCTCTGATG

AGTACGAG ACAACCCGTGGGCAAATTCTTCAGGAATACAGGAAAATCAAAAAG ACCAACACCAACTACAGCTGTGAGAAGCGACGCTGCGAATACCTG

CACCGCAAGCTGGCGCACATTAAGAGGCTCATCGCAGAGTATGACCAGCGGCAGCTTCAGGCCTGGCCCTAGCACAGACAGGCAGACCTGACGGCTCCGC

CTGCCTTTCCTAGTTTTATATGAACTCGGCCCTTTAGCTGCCGCAGAGACATCTATTTTTGTACCTTTTCTACTCCGTGCCTCCTCCAAGGCCCACGCCT

CCAAGTGTTAGAAGCCCCAGGGAGAGTGAGCAGCGAGTGCCAGGCCCTGCTGCCTTCAGATCCCCAGCGGACAAGGTTGCTGCAGTTTGCTGGCTGTGCC

CAAAGCTCTTAGCAGCGGCCTCCGCAGCATGTGCTCCTCAGTCCCCAACACACTGCCCTTCATGTCACACTGTGGCTGTGTGGTTCTGTCTGTCCCTCCA

TCCATTTGTGGGTCCTGGGATCACCTCCCTGCTGGGTCCCACTTGGGGGGTGCTGAGGGTGGCACCTTGCTTGCCTTCTCCAGGGCGCAGGCCTGAGGCC

CCCAATTGCTGCTTTCTCACTGTGCCTCGTCTCATACCCCAAATCCAAATCCAAGGGGCCATCAGTGTGCATGTGTCTGTGTGCGTGTACATGTAGTATG

AGTGGGTCTCCACACATTCAGAGGGAAGCCATTGGGGAGGTGGTGGGGGCCACTGCTGTAGGGCAGGGAAAGAATGTCAAAGACAGATGTCTATTTTTTT

AAATGGTGAAGATGTCTTTGGGTGGCTTCCAAAGAGCCTGGCTGCCTGGAGGCACCTGCCTGGCACAGTCCCCCACCCCCAGTCAGCTCTTAGCTTTCTT

TTGGGATTCCTAGAGTCCCCAGACCCTAGAGGAACCAAGCTTTCAATAGATGTTGGTTTCTTCTCCGGGGCAGGACCAGGCTCTGCATGGTGCACTTCTC

TCACAGCTACACTGCGCAGGCTCAGGGTAGATCCCAGGTTACCCCTCTCCTGCCCTGAGAACTCCATCCAGGGCTATTGATTGAACTGATGGTATGTTTG

AGTTGTTTCATTGTCTGAGATTTTGTTGTCTGTCTGAGATTTGGGAAAGGCAGGGCCACACTCTGGGGCTGCAGGTGGTGGCTGGCAGCTTAAGCATGGT

CTAACTTATTGGTGTTCTCCCCGCCTTTGAACTGTGCTGTGGAGAAAGTCTACTTTGAGCCATGGAGTTGGTGTTTACAAAGTCTTCACTTTTGCCAAAA

CGTTACAATTGACAGAGAGGCGGTGCCTCCAGGTCCTTTCTTAGAGTTTGTCTTCTGTACACAAAGCAGGTGAACCGCCAACTTTCAAAGTCTATAATAA

ATTTGATGGAATTT
Translation
MAALKEARSYGLSCGRVSDGSRVSVFHVKLTDSALKAFESYRAHQ - UNI3327 - DSVSLRPSIRFEGSQG - UNI2615 - HISIPQPDCPEEV

RAFSFYLSNIGRDSPQGSFDCIQQYVSS SYGDVHLDCLGSIQDKVTVCATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYMG - UNI25758 - G

KKVQFRKPAPGAADAVPSRKRATPINLASAIRKSSGSGASSVVQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDTLDSLLQQ VASVNPKDGTC

TLQDCMYKSLQKDWPGYSEGDRQLLKRMLMR RKLCQPQNATTDSSPPREHGRSASPSQ KRPTDFIDPLASKKPRISHFTQRAQPTLNGKLGAPNGHET

LLPAPGPTPSDTLSSSHLPPRLEPPRTHDPLADVSNDLGHSTQDYKHQEATPAPAPHLGLPLLTDFPQAEQPTSSSHTHSRPKKKSKKHKDKERPPEERP

PAPQPDAPTAPALPPDAPG - UNI14809 - GLNGACDNEPTSSSETPDYLL LKYPAISSSEQRQSYKNDFNAEYSEYRSLHARIEQITRRFTQLDA

QLRQLSQGSDEYE TTRGQILQEYRKIKK TNTNYSCEKRRCEYLHRKLAHIKRLIAEYDQRQLQAWP

For any suggestions or comments, please send an email to unitrap@crg.es