Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070047 (Fat1)
Chromosomal location
Chr 8: 46035568 - 46137611 (+)
Description
FAT tumor suppressor homolog 1 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:109168]
RefSeq_peptide
NP_001074755.2 
UniGene
Mm.410317 Mm.408946 
MGI
MGI:109168 
Uniprot/SPTREMBL
Q6X4A1 Q80VA2 Q80XT9 A7ISQ0 Q497H5 Q9QXA3 
Human Ortholog
ENSG00000083857 (FAT1)
Omim not available
UniTrap UNI8594
Vector Insertion
Chr 8: 46038836 - 46074284
Public Clones KST249 (baygenomics) TEA138 (baygenomics) GST070 (baygenomics) PST079 (baygenomics)
PST034 (baygenomics) RST018 (baygenomics) RST703 (baygenomics) PST127 (baygenomics)
LST100 (baygenomics) G016A12 (ggtc) G056C03 (ggtc) G014G09 (ggtc)
G016A11 (ggtc) G050B11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29579
Vector Insertion
Chr 8: 46038836 - 46074284
Public Clones (sanger) E323A04 (ggtc) E324H07 (ggtc) E324E02 (ggtc) E323H01 (ggtc)
E325B04 (ggtc) IST11770B1 (tigm) IST13225H10 (tigm) IST12590A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29574
Vector Insertion
Chr 8: 46074600 - 46092595
Public Clones (sanger) E324B10 (ggtc) E323D07 (ggtc) E325D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10254
Vector Insertion
Chr 8: 46095966 - 46098317
Public Clones RST011 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9830
Vector Insertion
Chr 8: 46103400 - 46108157
Public Clones RST291 (baygenomics) RST204 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10257
Vector Insertion
Chr 8: 46117009 - 46118708
Public Clones KST113 (baygenomics) ST519 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8927
Vector Insertion
Chr 8: 46119185 - 46119324
Public Clones RST639 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11178
Vector Insertion
Chr 8: 46127385 - 46127388
Public Clones G043C07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6262
Vector Insertion
Chr 8: 46130523 - 46135195
Public Clones CSD143 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110403
Sequence
TGAGAGCCTGGATTATGAAAGCTCCCACGAGTATTACCTGACCGTGGAAGCCACTGATGGAGGCACGCCTTCGTTGAGTGATGTGGCGACCGTGAACATC

AACGTCACAGACATCAACGATAACAGCCCCGTGTTCAGCCAAGACACCTACACCACCGTGGTCAGTGAGGATGCGGCTCTCGAGCAGCCTGTCATTACG 

- UNI8927 - ATTATGGCTGACGATGCTGATGGCCCCTCAAACAGCCACATCCACTACTCCATTATAGAGGGGAACCAGGGAAGTCCGTTCACAATTG

ACCCTGTCAGAGGAGAAGTGAAAGTGACGAAGCCCCTAGACCGGGAAACG - UNI8927 - ATCTCAGGTTATACACTCACGGTGCAAGCTGCCGACA

ACGGCAATCCACCCAGAGTCAACACAACCACGGTGAATATCGATGTCTCCGATGTCAATGACAACGCTCCCCTCTTCTCCAGAGACAACTACAGTGTCAT

CATCCAG GAGAACAAACCCGTGGGTTTCAGCGTTCTGAAGCTGGTAGTGACAGACAAGGACTCTTCCCACAACGGTCCCCCCTTCTTCTTCACTATTGT

GAGTGGAAATGATGAAAACGCCTTTGAGGTGAATCAGCATGGGGTCCTCCTGACAGCGGCGACGATCAAGAGGAAAGTGAAGGACCATTACCTTCTGCAT

GTTAAG GTGGCTGACAGCGGAAAGCCTCAGCTGTCATCCATGACACACATTGACATCAGGGTGATCGAGGAAAGCATCCACCCTCCTGCCATCTTGCCG

CTGGAGATTTTCATCACCGCCTTTGGAGAGGAATACTCAGGTGGGGTCATAGGAAAGATCCACGCCACCGACCAGGACGTGTATGACACCTTGATGTACA

GTCTGGATCCCCACATGGATGGCCTGTTCTCTGTCTCCAGCACGGGGGGCAAGCTGATTGCACACAGAAAGCTGGACATAGGCCAGTACCTTCTCAATGT

CAGCGTGACAGATGGGAAATTCACCACGGTGGCCGACATCACCGTGCACATCCAACAAGTGACCCAGGAGATGCTGAACCACACCGTCGCCATTCGCTTC

GCGAATCTCACCCCGGAGGAGTTTGTTGGTGACTACTGGCGCAACTTCCAGCGAGCCCTACGCAACATCCTGGGCGTCCGGAAGAATGACATACAGATCG

TCAGCCTGCAGCCCTCCGAACCCCATTCGCATCTGGACGTCTTACTCTTTGTCGAGAGGTCAGGCGGCACCCACGTTTCAACAAAGCAACTTCTGCATAA

GATTAATTCTTCCGTGACGGACGTTGAGGAAATCATTGGCGTGAGGATCCTGGAAGTGTTCCAGAAGCTCTGTGCGGGGCTGGATTGCCCGTGGAAGTTC

TGTGATGAGAAGGTGTCTGTGGATGAAAACGTCATGTCCACTCACAGCACGGCCAGACTGAGTTTCGTGACTCCCCGACACCACAGAACAGCAGTGTGTC

TCTGCAAAG ACGGGACATGCCCACCTGTCCACCATGGGTGTGAAGATAACCCCTGTCCCGCGGGATCTGAGTGTGTCGCGGATCCCCGAGAGGAGAAGT

ATAGCTGCGTGTGCCCCGGGGGCGGCTTCGGTAAATGCCCAG GGAGCTCATCTATAACTTTCACGGGAAACAGCTTCGTGAAGTACCGCCTGCTGGAGA

ATGAGAACAGACTGGAGATGAAGCTGAGCATGCGTCTGAGAACCTACTCCTCCCACGCGGTTGTCATGTACGCGCGAGGGACTGACTACAGCATCCTGGA

G ATTCATACCGGAAGACTGCAGTACAAATTTGACTGCGGAAGCGGCCCTGGGATTGTCTCCGTCCAGAGCATTCAGGTCAACGACGGGCAGTGGCACGC

GGTGTCCCTGGAAGTGGAGGGCAATTACGCCAAGCTGGTTCTGGATGAAGTCCACACCGCTTCGGGCACAGCCCCGGGGGCTCTGAAAACCCTCAACCTG

GACAACTACGTCTTTTTTGGTGGCCACCTCCGCCAGCAAGGGACAAAGCATGGGCGAGGCGCCCAGGTGGCCAGTGGCTTCAGGGGCTGCATGGATTCTA

TTTATTTGAACGGGCAGGAGTTGCCTCTGAACAACAAGCCAAGAGCCTACGCGCACATCGAAGAGTGGGTGGACCTATCTCATGGATGCTTATTGACCGC

CACAGAAGACTGCTCCAGCAGCCCCTGTCAGAATGGAGGCGTTTGCAATCCCTCGCCTACTGGAG GTTATTACTGCAAGTGCAGCGCGTTGTACGTAGG

GACGTTCTGTGAGGTGAGCGTCAACCCGTGCTCCTCCAACCCCTGCCTCTACGGAGGAACGTGCATGGTAGACAACGGCGGCTTTGTGTGCCAGTGCAGG

GGGCTGTACACTGGTCAGAG - UNI11178 - ATGTCAGCTTAGTCCGTACTGCAAAGATGATCCCTGTAAGAATGGTGGAACGTGTTTTGACAGTTT

GGATGGTGCTGTCTGTCAGTGTGACTCAGGCTTTAGGGGAGAAAG ATGTCAGAGTGACATCGATGAGTGTGCTGGGAACCCCTGTCGGAACGGGGCCCT

TTGCGAGAACACACACGGCTCCTATCACTGTAACTGCAGCCAGGAGTACAGAGGGAAGCACTGTGAGGATGCCTCTCCCAACCACTACGTGTCCACCCCG

TGGAACATCGGACTGGCCGAGGGAATAGGTATTATTGTGTTTATAGCTGGGATAGTCTTACTAGTGATGGTGTTCGTCCTCTGCCGGAAGATGATCAGTC

GGAAGAAGAAGCGCCAGGCTGAACCTGAAGACAAACGTTTGGGGCCAACCACGGCTTTCTTGCAGAGACCTTATTTTGATTCAAAGCTGAACAAGAACAT

TTACTCCGACATCCCGCCCCAGGTGCCGGTCCGTCCCATTTCCTACACTCCCAGCATTCCAAGCGACTCGAGAAACAACCTTGACCGCAATTCCTTCGAA

GGCTCCGCGATCCCAGAGCATCCAGAATTCAGCACCTTCAACCCCGAGTCTATGCACGGGCATCGAAAAGCCGTGGCTGTGTGCAGCGTAGCTCCAAACT

TGCCTCCACCGCCGCCTTCCAACTCGCCCTCAGACAGCGACTCCATACAGAAGCCTAGCTGGGACTTTGACTACGACG CTAAAGTGGTAGATCTGGATC

CCTGTCTCTCTAAGAAGCCCCTGGAGGAAAAGCCCTCCCAGCCATACAGTGCCCGGGAGAGCCTGTCTGAGGTGCAGTCGCTTAGCTCCTTCCAGTCAGA

GTCCTGTGATGACAATG - UNI6262 - GGTACCACTGGGATACATCAGACTGGATGCCAAGTGTCCCTCTGCCAGACATACAAGAGTTCCCCAATTA

CGAGGCTATTGACGAACACACACCCCTCTACTCGGCTGATCCAAACGCCATCGATACTGACTATTACCCTGGGGGTTATGACATTGAAAGTGACTTTCCA

CCCCCACCAGAGGACTTCCCTGCACCCGATGAACTGCCACCATTGCCTCCAGAGTTCAGCGACCAGTTCGAGTCCATACACCCACCCAGGGACATGCCTG

CAGCAGGTAGCTTGGGATCTTCCTCCCGGAGTCGGCAGAGGTTCAACCTGAATCAGTACCTGCCCAATTTCTACCCCGCCGATATGTCCGAACCTCAGAA

ACAAGGCGCTGGCGAGAACAGTCCATGTAGAGAACCCTACACCCCCTACCCCCCAGGGTATCAAAGAAACTTCGAAGCGCCCACCATAGAAAACATGCCC

ATGTCCGTGTACGCCTCGACGGCTTCCTGCTCCGACGTGTCAGCGTGCTGTGAAGTGGAGTCTGAGGTCATGATGAGCGACTACGAGAGCGGGGACGACG

GCCACTTCGAAGAGGTGACGATCCCTCCGCTAGATTCCCAGCAGCATACGGAAGTGTGACGCTCAAACTCCTCCCCAAAGTGCCTGGACTTTCATGAACC

TAGAGATGCTATCGGTGACATCCGCCGTTGTGTTGTTCTTTTGCAGCCGTCTGGGCCGCTTCTCGGTGAGCCGCGGTAGGCGTGGCTGCACGGAGTCACA

AGCCTCTTGACATGTTAGCCATTTCCAGCGTCCTAACTGACTGTAATCGACCGGGTTTTCATCCCCTGTCCCATCCCCTGAGCATCTTTTCGTATTTAGA

TTTGTCTCTGTTAAAATGATGAAACGGAAATCGGTCCTGTCGTCTTGTTAGCATGATTCATGTATTTATATAGATCCGATTATTTTAATTTTTGCTTTCT

TTGTGTAAATTTTATGTACAGATTTGATTTTTTGTTTTTTTTTGTTTGTTTGTTTGTTTTCCCCCCTCTCCTAGTTTTTACCTAGGTTTTCAGGACGCCT

CGTGTTTTTGTTTTCTGCTGGATCTGTGTGGTGGTGTTAGCGTCGTTTGCCTAGCATCTGATTTTCTGATGTAACCAGGGTTTCACGCTGTTCTTTTCCT

CTGAAGTATGACATTTCATTGACACATTTCGGTCCAGTGTAGCTGTACATATGGGGTGTGGACGACCTGTTACTGGACATGTCTTATTAAATGGGTTGCT

GTATTAGGATTATAAACATTTTTCATTATTGGAAAGTGTGAAGGGGACCTTCTGCATACCTGTTTAGAACCAAAACCACCACGACACGGTTTTTATAGTG

TCTGTATATTTGTGATGCAATGGTCTTGTAAAGGTTTTTACTGAAAACTATCATTAGCCAGCCTTTCTTACTGACAATAAATTATT
Translation
 - UNI8927 - MADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKPLDRET - UNI8927 - ISGYTLTVQAADNGNPPRVNTTTVNIDVS

DVNDNAPLFSRDNYSVIIQ ENKPVGFSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAFEVNQHGVLLTAATIKRKVKDHYLLHVK VADSGKPQLSSMT

HIDIRVIEESIHPPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLMYSLDPHMDGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITV

HIQQVTQEMLNHTVAIRFANLTPEEFVGDYWRNFQRALRNILGVRKNDIQIVSLQPSEPHSHLDVLLFVERSGGTHVSTKQLLHKINSSVTDVEEIIGVR

ILEVFQKLCAGLDCPWKFCDEKVSVDENVMSTHSTARLSFVTPRHHRTAVCLCKD DGTCPPVHHGCEDNPCPAGSECVADPREEKYSCVCPGGGFGKCP

G GSSSITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVMYARGTDYSILE IHTGRLQYKFDCGSGPGIVSVQSIQVNDGQWHAVSLEVEGNYAK

LVLDEVHTASGTAPGALKTLNLDNYVFFGGHLRQQGTKHGRGAQVASGFRGCMDSIYLNGQELPLNNKPRAYAHIEEWVDLSHGCLLTATEDCSSSPCQN

GGVCNPSPTGG GYYCKCSALYVGTFCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCRGLYTGQR - UNI11178 - RCQLSPYCKDDPCKNGGTCFDS

LDGAVCQCDSGFRGER RCQSDIDECAGNPCRNGALCENTHGSYHCNCSQEYRGKHCEDASPNHYVSTPWNIGLAEGIGIIVFIAGIVLLVMVFVLCRKM

ISRKKKRQAEPEDKRLGPTTAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESMHGHRKAVAVCSVA

PNLPPPPPSNSPSDSDSIQKPSWDFDYDA AKVVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDNG - UNI6262 - GYHWDTSDWM

PSVPLPDIQEFPNYEAIDEHTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRSRQRFNLNQY

LPNFYPADMSEPQKQGAGENSPCREPYTPYPPGYQRNFEAPTIENMPMSVYASTASCSDVSACCEVESEVMMSDYESGDDGHFEEVTIPPLDSQQHTEV
Transcript ENSMUST00000093529
Sequence
ATGGGGAGACACTTGACCTTGCTTCTGCTTCTGCTCCTCTTCCTCCAGCAGTTTGGAGACAGTGATGGCAGCCAAAGACTTGAACCCACCCCTCCTATCC

AGTTTACACACTTCCAGTACAATGTCACTGTGCACGAGAACTCGGCAGCGAAGACCTATGTTGGCCACCCCAGAAAGATGGGCATCTACATCTTAGACCC

CTCGTGGGAGATAAGGTACAAAATCGTCTCAGGAGACAGCGAAAACCTGTTCAAAGCGGAAGAGTATGTTCTCGGAGACTTCTGCTTTCTAAGGATAAGA

ACCAAAGGAGGGAATACCGCCATCCTGAACAGAGAAGTGAGAGACCATTACACGCTGATCGTCAAGGCAGTGGAGAAAGCCACCGATGCTGAGGCCCGAG

CGAAGGTTCGGGTACAAGTGCTGGATACAAACGACTTAAGGCCCTTATTCTCCCCCACCTCCTACAGCGTCTCTTTGCCGGAAAACACAGCCATAAGGAC

CAGCATCGCAAGAGTCAGTGCCACGGATGCGGACATTGGGACCAATGGCGAATTTTACTACAGTTTTAAAGACAGAACTGACGTGTTTGCTATCCACCCG

ACCAGCGGCGTCGTTGTTTTGACTGGCAGGCTTGATTTCCTAGAGACCCAGCTCTATGAGCTGGAGATTCTGGCTGCGGACCGGGGGATGAAGCTGTACG

GTAGCAGTGGGGTCAGCAGCCTGGCCAAGCTGACAGTTCACGTGGAGCAGGCCAACGAGTGCGCGCCCATCATAACCGCGGTGACGTTGTCGCCCTCTGA

GCTGGACAAGGACCCAACCTACGCCATCATCACCGTGGAGGACTGTGATCAGGGTGCCAACGGGGAGATAGCGTCTTTGAGCATCGTGGCTGGCGACCTC

CTTCAGCAGTTTAAAACAGTGAGGTCTTTCCCAGGGAGTAAAGCATTCAAAGTGAAAGCCGTCGGGGCCGTCGACTGGGACAGCCATCCTTACGGCTACA

ACCTGACATTGCAGGCTAAAGACAAAGGGACTCCTCCCCAGTTTTCCCCCGTGAAAGTTGTTCACATCATTTCTCCACAGTTCAGAGCTGGCCCTGTCAA

GTTTGAAATGGATGTTTACAGAGCCGAGATCAGTGAGTTTGCCCCTCCACATACACCCGTGGTCCTGGTCAAAGCCATTCCTAGTTATTCCCATTTGAGG

TATGTTTTTAAAAGCGCTCCTGGAAAACCTAAATTCGGTTTGAATCACAACACGGGTCTCATTTCCATTTTAGAACCCATTAGAAGGCAGCACACATCCC

ATTTTGAACTCGAGGTGACAACAAGTGACAAAAGAGCCTCCGCCCGAGTGGTGGTCAAAGTTTTAGGTACAAACAGCAACCCCCCTGAGTTTACACAGAC

CTCGTACAAAGCATCCATCGATGAGAACGCGCCTATCGGTGCCGCAGTCACGAGGGTGAGTGCGATGGACCCCGACGAGGGGGAGAATGGCTACGTGACT

TACAGTATTGCAAACTTAAATCACGTGCCGTTTGTCATTGACCACTTCACGGGAACCGTGAGTACCTCTGAGAATCTGGACTATGAACTGATGCCTCGCG

TGTACACGCTGAGGATCCGTGCGTCTGACTGGGGCTTGCCATACCGCCGGGAAGTCGAAGTCCTCGCCACGATTACTCTCAATAACCTGAATGACAACAC

ACCCCTGTTTGAGAGGATAAACTGTGAGGGGACCATTCCCCGAGACCTAGGTGTGGGGGAGCAGATAACCACCGTGTCTGCCATTGACGCCGACGAGCTG

CAGCTGGTCCGGTACCAGATTGAAGCCGGAAATGAGTTGGATTTGTTTGGCTTAAACCCCAGCTCCGGTGTGCTGTCCTTAAAGCACTCCCTCACGGATG

GCTTGGGCGCAAAGGTTTCCTTTCACAGTTTGAGAATCACAGCGACAGACGGAGAAAATTTTGCCACGCCGTTATACATCAACCTAACGGTGGCTGCCAG

TCGCAAGCCGGTCAACTTGCAGTGCGAGGAGACCGGTGTTGCCAAAATGTTGGCAGAGAAACTCCTGCAGGCGAATAAGTTACACAGTCAGGGGGACGTG

GAGGATATTTTCTTTGATTCTTACTCCGTCAATACCCATACTCCACAGTTCGGGGTTACTCTTCCAACTGGAATTGAGGTAAAGGAGAACCTCCCGGTGG

GTGCCAATATACTCTTCATGAATGCTACTGACCTTGACTCTGGCTTCAATGGAAAGCTCGTCTATGCTATTTCTGGAGGGAATGATGATAGTTGCTTTAC

CATCGACATGGAAACGGGAGTGCTGAAAGTCCTGTCTCCACTTGACCGTGAAGTAATGGACAAATACACCCTGAATATTACCGTGTACGACCTCGGTATA

CCCCAGAGGGCTGCCTGGCGCCTTCTGGACGTCACGGTTCTGGATGCCAATGACAATGCGCCCGAGTTTTTACAGGAGAGCTATTTTGTGGAAGTGAGTG

AAGACAAGGAGGTGAACAGTGAAATCATCCAGGTCGAAGCCACTGATAAAGATCTGGGCCCCAGCGGGCATGTGACCTACGCTATTCTCACAGATACGGA

GAAGTTTTCCATCGACAGCATGACCGGTGTGGTGAAAATTATCCAGCCTTTGGATCGTGAAGTGCAACCTGTGCATTACCTAAAGATCGAGGCCAGGGAC

CAAGCCACAGAGGAACCCCGGTTGTTCTCCACCGTGCTCCTGAAGGTGTCACTAGATGACGTTAATGACAACCCACCTAGGTTCATCCCACCCAATTACT

CAGTGAAAGTTCGAGAAGATCTACCAGAAGGAACCATCATCATGTGGTTAGAAGCCTATGATCCCGATGTGGGTCAGTCAAGTCAGGTGAGATACAGCCT

CCTGGATCACGGAGAAGGCCACTTTGATGTGGATAAACTCAGCGGCGCAGTTAGAATTGTCCAGCAGCTGGACTTTGAGAAGAAGCAACTGTATAATCTC

ACCGTGAGGGCCAAAGACAAAGGGAAGCCCGTGTCCCTGTCTTCCACTTGCTATGTGGAAGTGGAGGTCGTTGACGTGAATGAGAACCTACACACTCCGG

TGTTCTCCAGCTTTGTGGAGAAGGGTGTAGTGAAAGAAGACGTCCCTACTGGCTCATCAGTCATGACCGTGTCAGCTCACGACGAAGACACAGGCAGAGA

CGGAGAGATCCGGTATTCCATTAGAGATGGCTCTGGAATTGGTGTCTTCAGGATAGATGAAGAAACAG - UNI8594 - - UNI29579 - GTGTTA

TAGAGACTTCAGACCGACTGGATAGAGAGTCGACTTCCCACTACTGGCTCACGGTCTATGCCACAGATCAGGGCGTGGTGCCTCTGTCGTCCTTCATAGA

GGTCTACATAGAGGTGGAGGATGTCAATGACAACGCGCCACAGACATCAGAACCCGTGTACTATCCAGAAATCATGGAAAACTCACCCAAGGATGTATCT

GTGGTCCAGATTGAGGCTTTTGACCCGGATTCTAGCTCCAATGACAAACTGACATACAGAATTACAAGCGGGAACCCTCAAGGATTCTTCTCAATACATC

CTAAGACAG - UNI29574 - GTCTCATCACAACCACGTCGAGGAAGCTGGACCGAGAACAGCAGGACGAGCACATTCTAGAA GTTACTGTGACAGA

CAACGGTGTTCCCCCCAGATCCACCATTGCCAGAGTCATCGTGAAAATCCTCGATGAGAACGACAACAGGCCTCAATTCCTTCAGAAGTTTTACAAAATC

AGGCTCCCAGAGCGGGAAAAGGCGGACGGGGACCGGAGCGCTTCGAAGCGCGAGCCCCTCTACCGCGTCATAGCCGCGGATAAGGACGAGGGGCCCAATG

CGGAGCTCTCCTACAGCATCGAGGAAGGCAACGAGCACGGCAGGTTCTCCATCGAACCCAAAACGGGAGTGGTCTCGTCCAAAAAGTTTTCTGCGGCCGG

AGAATATGACATTCTTTCC ATTAAGGCAGTTGACAACGGGCGCCCCCAGAAGTCGTCCACCACCAGGCTCCATATCGAGTGGATCTCCAAACCCAAGCC

GTCCTCGGAGCCGATTTCGTTTGAGGAATCGGTTTTCTCATTTACCGTAATGGAAAGTGATCCGGTGGCTCACATGATCGGCGTGATCTCAGTTGAGCCC

CCTGGCATGCCTCTGTGGTTTGACATCATCG - UNI10254 - GTGGCAACTATGACAGCCACTTTGATGTGGACAAGGGCACCGGAACTATCATCGT

TGCTAAGCCCCTTGATGCAGAACAGAAATCCAGCTATAACCTCACCGTGGAGGCAACAGATGGGACCACCACGATCCTCACCCAG GTCCTCATCAAAGT

AATAGATACCAATGACCACCGCCCCCAGTTTTCTACATCGAAATACGAAGTTGCTGTTCCTGAGGACACAGAGCCAGAAGTGGAGATTCTGCAGATCAGT

GCAGTAGATAGGGATGAGAAAAACAAGTTGATCTACACTCTGCAGAGCAGCATCGATCCAGCCAGCCTCAAGAAATTCCGCCTCGATCCCGCAACAGGCG

CTCTTTACACTGCTGAAAAGCTTGACCATGAAGCCATTCACCAGCACGTTCTCACGGTCATG GTCCGGGATCAGGATGTCCCTGTGAAACGAAACTTTG

CCAGGATTGTTGTCAATGTCAGTGACAAGAATGACCACGCACCGTGGTTCACCAGTCCGTCCTACGACGGGCGGGTTTATGAATCGGCAGCCGTGGGCTC

AGTTGTGCTGCAAGTGACAGCTCTGGACAAAGACAAAGGGAGGAACGCTGAAGTGCTCTACTCGATCGAGTCAG - UNI9830 - GAAACATTGGAAA

TTCTTTTACAATTGACCCCATCTTGGGCTCTATAAAAACTGCCAGAGAATTGGACCGAAGTCACCAAGTAGATTATGATTTAATGGTAAAAGCTACAGAC

AAAGGCGATCCACCTATGAGCGAGATGACCTCCGTGCGTATCGCTGTCACTGTTGCTGACAATGCCTCTCCCAAGTTCACATCCAAAGAGTACTCTGCGG

AGATTAGTGAAGCCATCAGGATTGGAAGTTTTGTTGGGATGGTCTCTGCACACAGCCAGTCATCAGTGATGTATGAAATAAGAGACGGAAACATGGGCGA

CGCATTTAACATTAACCCGCATTCCGGAAGCATCATCACTCAGAGAGCCTTGGATTTTGAAACACTGCCCATGTATTCATTGACAGTGCAAGGGACCAAC

ATGGCCGGTTTGTCCACCAACACAACGGTGGTGGTGCACGTGCGGGATGAGAACGACAACCCGCCCGTTTTCACGCAGGCAGAATATTCAGGATTCATCA

GCGAGTCAGCCTCCGTCAACAGTGTGGTGCTGACAGACAGGAACGTTCCGCTGGTGATTCGAGCGACGGATGCTGACAGGGAATCCAATGCTCTGCTCGT

CTATCAAATCGTTGAGCCGTCCGTGCACAACTATTTTGCTATTGACCCCACCACCGGCGCCATCCGTACAGTGCTGAGTCTGGACTATGAAGAAACACAT

GCTTTTCACTTCACCGTCCAAGTGCACGACATGGGGACTCCTCGTCTGTTCGCCGAGTACGCAGCGAATGTGACTGTGCACGTGATCGACATCAACGACT

GCCCCCCTGTCTTCTCTAAGTCACTGTACGAAGTGTCTCTTCTCCTGCCGACATACAGAGGCGTGAACGTCATCACGGTGAACGCCACAGACGCTGACTC

CAAGGCATTCTCCCAGGTCATGTACTCCATCACTGAAGGCAACATTGGGGAGAAGTTCTCAATGGACCACAAGACTGGCACCATCGCAATACAGAACACG

ACTCAGCTACGAAGCCGCTATGAGCTGACCGTCCGCGCCTCCGACGGCAGGTTCACAAGCATGGCCTCCGTGAAAATCAACGTAAAGGAGAGCAGAGAGA

GTCCCCTCAAGTTTACCCAAGACGCCTACTCCGCAGTTGTGAAAGAGAACTCCACGGAAGCCAGAACGTTAGCTGTCATCACTGCGATAGGGAACCCACT

CAATGAGCCTTTGTTTTACCGCATCCTCAACCCAGACCGCAGATTTAAAATCAGCCACACGTCGGGCGTGTTGTCCACCACCGGGATACCGTTTGACCGT

GAGCAACAGGAGACGTTTGACGTGGTGGTAGAGGTGACTAAGGAACACGAGCCGTCAGCGGTGGCCCACGTCGTGGTGAAAGTCACCGTCGAAGACCAGA

ATGATAATGCTCCAGTGTTTGTTAACCTTCCCTACTACGCTGTGGTGAAGGTGGATGCTGAGGTGGGCCACGTCATTCGCTATGTTACTGCCATTGACAG

AGACAGTGGCAGAAATGGTGACATACACTACTACCTTAAGGAGCATCATGACCACTTCCAGATTGGACCTTCTGGCGACATTTCTCTGAAGAAGCAGTTT

GAGCATGACACTTTAAATAAAGAATACCTTGTCACAGTGGTCGCCAAGGACGGAGGGAGTCCAGCTTTCTCTGCAGAAGTTCTGGTTCCCATCACTGTCA

TGAACAAAGCCATGCCCGTGTTTGAAAAGGCTTTCTATAGCGCTGAGATCCCAGAGAACATCCAGATGCACAGCCCAGTGGTCCATATCCAAGCCAACAG

CCCAGAAGGGCTGAAAGTGTTCTACAGTATCACGGACGGAGACCCTTTTAGTCAGTTTACTATTAACTTCAACACTGGGGTGGTAAACGTCATAGCACCA

CTGGATTTTGAGTCCCACCCAGCCTATAAGCTAAGCGTGCGGGCAACTGACTCCCTGACGGGCGCTCACGCTGAAGTGTTTGTTGACATCATAGTGGAAG

ACATCAATGATAACCCTCCTGTGTTTGTGCAGCCATCTTACTCCACAACCCTGTCTGAAGCATCTGTAATTGGAACACCTGTCCTTCAAGTTCGAGCCAC

AGATTCCGACTCGGAACCAAACAGAGGAATTTCCTACCAGCTGATTGGAAATCACAGCAAAAGTCACGATCATTTTCACATAGATAGTAACACGGGGCTC

ATTTCACTAGTGAGAGCTTTGGATTACGAACAGTCCCAGCAGCACAGGATCTTCGTAAGGGCTGTTGATGGAGGGATGCCCGCCCTGAGCAGTGACGTGG

TCGTCACTGTGGCTGTCACCGACCTCAATGATAACCCACCTCTGTTTGAACAACAGGTTTATGAAGCCAGAATCAGCGAGCACGCCGCACACGGGCATTT

CGTGATGTGTGTGAGAGCCTGCGATGCAGACAGCTCAGACCTAGACAAGTTAGAGTACTCTATTCTGTCTGGCAATGATCATAAAAGCTTCATCATCGAC

AGGGAAACGGGAATTATCACGCTCTCCAACCTCCGCCGCCACACCCTGAAGCCGTTCTACAGCCTCAACGTTTCGGTGTCTGATGGGGTTTTCCGGAGCT

CGGCTCGGGTTAACGTAACTGTGATGGGAGGGAATTTGCACAGTCCTGTTTTTCACCAGAACGAATACGAAGTGGAGCTAGCTGAAAACGCTCCCTTGCA

CACCCTGGTGGTCCAAGTGAAGGCATCTGACAGAGATTCTGGCATTTACAGCCACGTAACTTACCACATTGTAAATGACTTTGCCAAAGACAGGTTTTAT

GTGAATGACAGAGGGCAGATTTTCACTTTGGAGAAACTTGACCGAGAGACACCGGCGGAGAAAGTGATCTCGATCCGCTTGATGGCTAAGGATGCTGGGG

GGAAGGTTGCTTTCTGCACCGTCAATGTCATCCTCACAGACGACAATGACAACGCACCTCAGTTTCGCTCAACCAAGTACGAGGTGAACATCGGGTCCAG

CGCTGCCAAAGGGACGTCGGTCGTCAAGGTCTTTGCGAGTGACGCTGATGAGGGATCGAATGCTGACGTCACCTACGCCATTGAGGCGGATTCTGAAAGT

GTCAAGGAGAACTTGGAAATCAACAAGCTGACTGGCCTGATTACTACAAAGGAAAGTTTAATAGGTTTAGAGAATGAGTTCTTCACTTTCTTCGTTAGAG

CCGTGGATAGCGGGTCTCCGCCCAGAGAGTCTGTCGTTCCTGTCTATATTAAAATACTTCCACCAGAAGTGCAGCTTCCTAGGTTCTCAGAGCCCTTTTA

TACCTATACCATCTCAGAAGACACGCCCATTGGAACAGAAATTGACCTCATCCGGGTAGAACATGGCGGGGCTGTTCTTTACATCCTTGTCAAAGGCAAT

ACTCCTGAGAGTAATCGAGATGAGTTCTTTGTGATCGACAGGCAGAATGGGAGACTGAAACTGGAGAAGAGCCTTGACCATGAGACCACTAAGTGGTATC

AGTTTTCCATCCTGGCCAGATGCACTCTTGATGACTACGAGGTGGTGGCTTCTATAGATGTCAGTATCCAGGTGAAAGATGCTAATGATAACAGCCCAGT

TTTGGAGTCCAGTCCCTATGAGGCATTTATTGTTGAAAACCTGCCAGGGGGAAGCAGGGTCATCCAGATCAGAGCATCTGACCTAGACTCAGGAGCCAAC

GGCCAAGTCATGTACAGCCTAGACCAATCCCAAGACGCAGACATCATCGAATCTTTTGCCATTAACATGGAAACAGGCTGGATTACAACTCTCAAGGAGC

TTGACCACGAAGAGAGGGCCAGTTACCAGATTAAAGTGGTCGCGTCGGATCACGGTGAGAAGGTGCAGCTGTCTTCCACCGCCATTGTGGGTGTTACCGT

CACTGACGTCAACGACAGCCCGCCGAGATTCACGGCTGAGATTTACAAAGGGACGGTGAGTGAGGATGACCCTCCAGGTGGCGTGATCGCCATCTTAAGC

ACGACCGATGCTGACACTGAAGAGATCAACAGACAGGTGTCATACTTCATCACAG GAGGGGATGCCTTGGGACAGTTTGCTGTGGAAAATGTGCAGAGT

GACTGGAGGGTGTATGTGAAGAAGCCCCTCGACAGGGAACAAAAGGATAGTTACCTTCTGACTGTCACAGCAACAGACGGGACCTTCTCTTCCAAAGCTA

GAGTTGAAGTCAAAGTTCTCGATGCCAACGACAACAGTCCAGTCTGTGAGAAG ACCTCGTATTCTGATACCATTCCTGAAGACGCCCTTCCCGGGAAGC

TGGTCATGCAGGTCTCTGCCACAGACGCGGATATCCGGTCCAACGCAGAGATTACTTACACTTTATTTGGTTCAGGTGCAGAGAAGTTTAAACTGAATCC

AGACACAG GTGAACTGAGAACACTAGCCCTCCTTGATCGTGAGGAACAAGCAGTTTATAATCTTCTAGTCAAGGCCACGGACGGAGGTGGGAGGTCCTG

TCAGGCGGCTATTGTGCTCACGTTAGAAGATGTGAACGATAATGCTCCTGAGTTCACCGCGGAGCCCTACACCATCACGGTATTCGAGAACACAGAGCCT

GGGACACCGCTGACCAGAGTGCAGGCCACTGATGCAGACACAG GATTGAATCGGAAGATTTCCTACTCGCTGGTCGAATCCGCTGACGGGCAGTTCTCC

ATTAATGAGAGATCTGGAATTATCCAGTTGGAAAAGCATTTGGACAGGGAACTACAGGCAGTCTATACTCTCACTTTGAAAGCAGTGGACCAAGGATTGC

CAAGGAGATTGACAGCTACTGGCACGGTGGTTGTGTCTGTTTTGGATATAAACGACAACCCGCCAGTGTTTGAGTACCGTGAATATGGCGCCAGTGTGTC

TGAGGACATTGTCATTGGGACGGAGGTTCTCCAGGTGTACGCCGCAAGTCGGGATATCGAGGCCAACGCGGAAATCACCTACGCCATCATAAGTGGAAAT

GAACATGGAAAATTCAGCATCGATTCTAAGACAG - UNI10257 - GGGCCATATTTATCATTGAGAGCCTGGATTATGAAAGCTCCCACGAGTATTA

CCTGACCGTGGAAGCCACTGATGGAGGCACGCCTTCGTTGAGTGATGTGGCGACCGTGAACATCAACGTCACAGACATCAACGATAACAGCCCCGTGTTC

AGCCAAGACACCTACACCACCGTGGTCAGTGAGGATGCGGCTCTCGAGCAGCCTGTCATTACG - UNI8927 - ATTATGGCTGACGATGCTGATGGC

CCCTCAAACAGCCACATCCACTACTCCATTATAGAGGGGAACCAGGGAAGTCCGTTCACAATTGACCCTGTCAGAGGAGAAGTGAAAGTGACGAAGCCCC

TAGACCGGGAAACG - UNI8927 - ATCTCAGGTTATACACTCACGGTGCAAGCTGCCGACAACGGCAATCCACCCAGAGTCAACACAACCACGGTGA

ATATCGATGTCTCCGATGTCAATGACAACGCTCCCCTCTTCTCCAGAGACAACTACAGTGTCATCATCCAG GAGAACAAACCCGTGGGTTTCAGCGTTC

TGAAGCTGGTAGTGACAGACAAGGACTCTTCCCACAACGGTCCCCCCTTCTTCTTCACTATTGTGAGTGGAAATGATGAAAACGCCTTTGAGGTGAATCA

GCATGGGGTCCTCCTGACAGCGGCGACGATCAAGAGGAAAGTGAAGGACCATTACCTTCTGCATGTTAAG GTGGCTGACAGCGGAAAGCCTCAGCTGTC

ATCCATGACACACATTGACATCAGGGTGATCGAGGAAAGCATCCACCCTCCTGCCATCTTGCCGCTGGAGATTTTCATCACCGCCTTTGGAGAGGAATAC

TCAGGTGGGGTCATAGGAAAGATCCACGCCACCGACCAGGACGTGTATGACACCTTGATGTACAGTCTGGATCCCCACATGGATGGCCTGTTCTCTGTCT

CCAGCACGGGGGGCAAGCTGATTGCACACAGAAAGCTGGACATAGGCCAGTACCTTCTCAATGTCAGCGTGACAGATGGGAAATTCACCACGGTGGCCGA

CATCACCGTGCACATCCAACAAGTGACCCAGGAGATGCTGAACCACACCGTCGCCATTCGCTTCGCGAATCTCACCCCGGAGGAGTTTGTTGGTGACTAC

TGGCGCAACTTCCAGCGAGCCCTACGCAACATCCTGGGCGTCCGGAAGAATGACATACAGATCGTCAGCCTGCAGCCCTCCGAACCCCATTCGCATCTGG

ACGTCTTACTCTTTGTCGAGAGGTCAGGCGGCACCCACGTTTCAACAAAGCAACTTCTGCATAAGATTAATTCTTCCGTGACGGACGTTGAGGAAATCAT

TGGCGTGAGGATCCTGGAAGTGTTCCAGAAGCTCTGTGCGGGGCTGGATTGCCCGTGGAAGTTCTGTGATGAGAAGGTGTCTGTGGATGAAAACGTCATG

TCCACTCACAGCACGGCCAGACTGAGTTTCGTGACTCCCCGACACCACAGAACAGCAGTGTGTCTCTGCAAAG ACGGGACATGCCCACCTGTCCACCAT

GGGTGTGAAGATAACCCCTGTCCCGCGGGATCTGAGTGTGTCGCGGATCCCCGAGAGGAGAAGTATAGCTGCGTGTGCCCCGGGGGCGGCTTCGGTAAAT

GCCCAG GGAGCTCATCTATAACTTTCACGGGAAACAGCTTCGTGAAGTACCGCCTGCTGGAGAATGAGAACAGACTGGAGATGAAGCTGAGCATGCGTC

TGAGAACCTACTCCTCCCACGCGGTTGTCATGTACGCGCGAGGGACTGACTACAGCATC CCTGGGATTGTCTCCGTCCAGAGCATTCAGGTCAACGACG

GGCAGTGGCACGCGGTGTCCCTGGAAGTGGAGGGCAATTACGCCAAGCTGGTTCTGGATGAAGTCCACACCGCTTCGGGCACAGCCCCGGGGGCTCTGAA

AACCCTCAACCTGGACAACTACGTCTTTTTTGGTGGCCACCTCCGCCAGCAAGGGACAAAGCATGGGCGAGGCGCCCAGGTGGCCAGTGGCTTCAGGGGC

TGCATGGATTCTATTTATTTGAACGGGCAGGAGTTGCCTCTGAACAACAAGCCAAGAGCCTACGCGCACATCGAAGAGTGGGTGGACCTATCTCATGGAT

GCTTATTGACCGCCACAGAAGACTGCTCCAGCAGCCCCTGTCAGAATGGAGGCGTTTGCAATCCCTCGCCTACTGGAG GTTATTACTGCAAGTGCAGCG

CGTTGTACGTAGGGACGTTCTGTGAGGTGAGCGTCAACCCGTGCTCCTCCAACCCCTGCCTCTACGGAGGAACGTGCATGGTAGACAACGGCGGCTTTGT

GTGCCAGTGCA - UNI11178 - AGGTATGTTTGTATCTCTTTCTTAGTGACTT ATGTCAGCTTAGTCCGTACTGCAAAGATGATCCCTGTAAGAAT

GGTGGAACGTGTTTTGACAGTTTGGATGGTGCTGTCTGTCAGTGTGACTCAGGCTTTAGGGGAGAAAG ATGTCAGAGTGACATCGATGAGTGTGCTGGG

AACCCCTGTCGGAACGGGGCCCTTTGCGAGAACACACACGGCTCCTATCACTGTAACTGCAGCCAGGAGTACAGAGGGAAGCACTGTGAGGATGCCTCTC

CCAACCACTACGTGTCCACCCCGTGGAACATCGGACTGGCCGAGGGAATAGGTATTATTGTGTTTATAGCTGGGATAGTCTTACTAGTGATGGTGTTCGT

CCTCTGCCGGAAGATGATCAGTCGGAAGAAGAAGCGCCAGGCTGAACCTGAAGACAAACGTTTGGGGCCAACCACGGCTTTCTTGCAGAGACCTTATTTT

GATTCAAAGCTGAACAAGAACATTTACTCCGACATCCCGCCCCAGGTGCCGGTCCGTCCCATTTCCTACACTCCCAGCATTCCAAGCGACTCGAGAAACA

ACCTTGACCGCAATTCCTTCGAAGGCTCCGCGATCCCAGAGCATCCAGAATTCAGCACCTTCAACCCCGAGTCTATGCACGGGCATCGAAAAGCCGTGGC

TGTGTGCAGCGTAGCTCCAAACTTGCCTCCACCGCCGCCTTCCAACTCGCCCTCAGACAGCGACTCCATACAGAAGCCTAGCTGGGACTTTGACTACGAC

G CTAAAGTGGTAGATCTGGATCCCTGTCTCTCTAAGAAGCCCCTGGAGGAAAAGCCCTCCCAGCCATACAGTGCCCGGGAGAGCCTGTCTGAGGTGCAG

TCGCTTAGCTCCTTCCAGTCAGAGTCCTGTGATGACAATG - UNI6262 - AATCTTTGGCTGCTCCTGACCTCAGCAAACCAAGAG GGTACCACTG

GGATACATCAGACTGGATGCCAAGTGTCCCTCTGCCAGACATACAAGAGTTCCCCAATTACGAGGCTATTGACGAACACACACCCCTCTACTCGGCTGAT

CCAAACGCCATCGATACTGACTATTACCCTGGGGGTTATGACATTGAAAGTGACTTTCCACCCCCACCAGAGGACTTCCCTGCACCCGATGAACTGCCAC

CATTGCCTCCAGAGTTCAGCGACCAGTTCGAGTCCATACACCCACCCAGGGACATGCCTGCAGCAGGTAGCTTGGGATCTTCCTCCCGGAGTCGGCAGAG

GTTCAACCTGAATCAGTACCTGCCCAATTTCTACCCCGCCGATATGTCCGAACCTCAGAAACAAGGCGCTGGCGAGAACAGTCCATGTAGAGAACCCTAC

ACCCCCTACCCCCCAGGGTATCAAAGAAACTTCGAAGCGCCCACCATAGAAAACATGCCCATGTCCGTGTACGCCTCGACGGCTTCCTGCTCCGACGTGT

CAGCGTGCTGTGAAGTGGAGTCTGAGGTCATGATGAGCGACTACGAGAGCGGGGACGACGGCCACTTCGAAGAGGTGACGATCCCTCCGCTAGATTCCCA

GCAGCATACGGAAGTGTGACGCTCAAACTCCTCCCCAAAGTGCCTGGACTTTCATGAACCTAGAGATGCTATCGGTGACATCCGCCGTTGTGTTGTTCTT

TTGCAGCCGTCTGGGCCGCTTCTCGGTGAGCCGCGGTAGGCGTGGCTGCACGGAGTCACAAGCCTCTTGACATGTTAGCCATTTCCAGCGTCCTAACTGA

CTGTAATCGACCGGGTTTTCATCCCCTGTCCCATCCCCTGAGCATCTTTTCGTATTTAGATTTGTCTCTGTTAAAATGATGAAACGGAAATCGGTCCTGT

CGTCTTGTTAGCATGATTCATGTATTTATATAGATCCGATTATTTTAATTTTTGCTTTCTTTGTGTAAATTTTATGTACAGATTTGATTTTTTGTTTTTT

TTTGTTTGTTTGTTTGTTTTCCCCCCTCTCCTAGTTTTTACCTAGGTTTTCAGGACGCCTCGTGTTTTTGTTTTCTGCTGGATCTGTGTGGTGGTGTTAG

CGTCGTTTGCCTAGCATCTGATTTTCTGATGTAACCAGGGTTTCACGCTGTTCTTTTCCTCTGAAGTATGACATTTCATTGACACATTTCGGTCCAGTGT

AGCTGTACATATGGGGTGTGGACGACCTGTTACTGGACATGTCTTATTAAATGGGTTGCTGTATTAGGATTATAAACATTTTTCATTATTGGAAAGTGTG

AAGGGGACCTTCTGCATACCTGTTTAGAACCAAAACCACCACGACACGGTTTTTATAGTGTCTGTATATTTGTGATGCAATGGTCTTGTAAAGGTTTTTA

CTGAAAACTATCATTAGCCAGCCTTTCTTACTGACAATAAATTATT
Translation
MGRHLTLLLLLLLFLQQFGDSDGSQRLEPTPPIQFTHFQYNVTVHENSAAKTYVGHPRKMGIYILDPSWEIRYKIVSGDSENLFKAEEYVLGDFCFLRIR

TKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDVFAIHP

TSGVVVLTGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDL

LQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHLR

YVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSDKRASARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVT

YSIANLNHVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADEL

QLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDV

EDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGI

PQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARD

QATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNL

TVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETG - UNI8594

 - - UNI29579 - GVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSND

KLTYRITSGNPQGFFSIHPKTG - UNI29574 - GLITTTSRKLDREQQDEHILE VTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPE

REKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGEYDILS IKAVDNGRPQKSSTTRLHIEWISKPKPSSE

PISFEESVFSFTVMESDPVAHMIGVISVEPPGMPLWFDIIG - UNI10254 - GGNYDSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATDGTTTIL

TQ VLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDEKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVM VRDQ

DVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESG - UNI9830 - GNIGNSFTIDPILGSIKTAR

ELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHSQSSVMYEIRDGNMGDAFNINPHSGSIITQR

ALDFETLPMYSLTVQGTNMAGLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESNALLVYQIVEPSVHNYFAID

PTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNI

GEKFSMDHKTGTIAIQNTTQLRSRYELTVRASDGRFTSMASVKINVKESRESPLKFTQDAYSAVVKENSTEARTLAVITAIGNPLNEPLFYRILNPDRRF

KISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHVIRYVTAIDRDSGRNGDIHYYLKEH

HDHFQIGPSGDISLKKQFEHDTLNKEYLVTVVAKDGGSPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENIQMHSPVVHIQANSPEGLKVFYSITDGDP

FSQFTINFNTGVVNVIAPLDFESHPAYKLSVRATDSLTGAHAEVFVDIIVEDINDNPPVFVQPSYSTTLSEASVIGTPVLQVRATDSDSEPNRGISYQLI

GNHSKSHDHFHIDSNTGLISLVRALDYEQSQQHRIFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEARISEHAAHGHFVMCVRACDADSSDLD

KLEYSILSGNDHKSFIIDRETGIITLSNLRRHTLKPFYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKASDRDSGI

YSHVTYHIVNDFAKDRFYVNDRGQIFTLEKLDRETPAEKVISIRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRSTKYEVNIGSSAAKGTSVVKVFASDA

DEGSNADVTYAIEADSESVKENLEINKLTGLITTKESLIGLENEFFTFFVRAVDSGSPPRESVVPVYIKILPPEVQLPRFSEPFYTYTISEDTPIGTEID

LIRVEHGGAVLYILVKGNTPESNRDEFFVIDRQNGRLKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESSPYEAFIVENLP

GGSRVIQIRASDLDSGANGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEERASYQIKVVASDHGEKVQLSSTAIVGVTVTDVNDSPPRFTAEIY

KGTVSEDDPPGGVIAILSTTDADTEEINRQVSYFITG GGDALGQFAVENVQSDWRVYVKKPLDREQKDSYLLTVTATDGTFSSKARVEVKVLDANDNSP

VCEK TSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEKFKLNPDTG GELRTLALLDREEQAVYNLLVKATDGGGRSCQAAIVLTLEDV

NDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTG GLNRKISYSLVESADGQFSINERSGIIQLEKHLDRELQAVYTLTLKAVDQGLPRRLTATGTV

VVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTG - UNI10257 - GAIFIIESLDYESSHEY

YLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVIT - UNI8927 - IMADDADGPSNSHIHYSIIEGNQGSPFTIDPV

RGEVKVTKPLDRET - UNI8927 - ISGYTLTVQAADNGNPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQ ENKPVGFSVLKLVVTDKDSSHNGP

PFFFTIVSGNDENAFEVNQHGVLLTAATIKRKVKDHYLLHVK VADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYSGGVIGKIHATDQD

VYDTLMYSLDPHMDGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTVAIRFANLTPEEFVGDYWRNFQRALRNILGV

RKNDIQIVSLQPSEPHSHLDVLLFVERSGGTHVSTKQLLHKINSSVTDVEEIIGVRILEVFQKLCAGLDCPWKFCDEKVSVDENVMSTHSTARLSFVTPR

HHRTAVCLCKD DGTCPPVHHGCEDNPCPAGSECVADPREEKYSCVCPGGGFGKCPG GSSSITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVM

YARGTDYSI PGIVSVQSIQVNDGQWHAVSLEVEGNYAKLVLDEVHTASGTAPGALKTLNLDNYVFFGGHLRQQGTKHGRGAQVASGFRGCMDSIYLNGQ

ELPLNNKPRAYAHIEEWVDLSHGCLLTATEDCSSSPCQNGGVCNPSPTGG GYYCKCSALYVGTFCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCK - U

NI11178 - KVCLYLFLSDL LCQLSPYCKDDPCKNGGTCFDSLDGAVCQCDSGFRGER RCQSDIDECAGNPCRNGALCENTHGSYHCNCSQEYRGKH

CEDASPNHYVSTPWNIGLAEGIGIIVFIAGIVLLVMVFVLCRKMISRKKKRQAEPEDKRLGPTTAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIP

SDSRNNLDRNSFEGSAIPEHPEFSTFNPESMHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFDYDA AKVVDLDPCLSKKPLEEKPSQPYSAR

ESLSEVQSLSSFQSESCDDNE - UNI6262 - ESLAAPDLSKPRG GYHWDTSDWMPSVPLPDIQEFPNYEAIDEHTPLYSADPNAIDTDYYPGGYDI

ESDFPPPPEDFPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRSRQRFNLNQYLPNFYPADMSEPQKQGAGENSPCREPYTPYPPGYQRNFEAPT

IENMPMSVYASTASCSDVSACCEVESEVMMSDYESGDDGHFEEVTIPPLDSQQHTEV
Transcript ENSMUST00000098796
Sequence
ATGGGGAGACACTTGACCTTGCTTCTGCTTCTGCTCCTCTTCCTCCAGCAGTTTGGAGACAGTGATGGCAGCCAAAGACTTGAACCCACCCCTCCTATCC

AGTTTACACACTTCCAGTACAATGTCACTGTGCACGAGAACTCGGCAGCGAAGACCTATGTTGGCCACCCCAGAAAGATGGGCATCTACATCTTAGACCC

CTCGTGGGAGATAAGGTACAAAATCGTCTCAGGAGACAGCGAAAACCTGTTCAAAGCGGAAGAGTATGTTCTCGGAGACTTCTGCTTTCTAAGGATAAGA

ACCAAAGGAGGGAATACCGCCATCCTGAACAGAGAAGTGAGAGACCATTACACGCTGATCGTCAAGGCAGTGGAGAAAGCCACCGATGCTGAGGCCCGAG

CGAAGGTTCGGGTACAAGTGCTGGATACAAACGACTTAAGGCCCTTATTCTCCCCCACCTCCTACAGCGTCTCTTTGCCGGAAAACACAGCCATAAGGAC

CAGCATCGCAAGAGTCAGTGCCACGGATGCGGACATTGGGACCAATGGCGAATTTTACTACAGTTTTAAAGACAGAACTGACGTGTTTGCTATCCACCCG

ACCAGCGGCGTCGTTGTTTTGACTGGCAGGCTTGATTTCCTAGAGACCCAGCTCTATGAGCTGGAGATTCTGGCTGCGGACCGGGGGATGAAGCTGTACG

GTAGCAGTGGGGTCAGCAGCCTGGCCAAGCTGACAGTTCACGTGGAGCAGGCCAACGAGTGCGCGCCCATCATAACCGCGGTGACGTTGTCGCCCTCTGA

GCTGGACAAGGACCCAACCTACGCCATCATCACCGTGGAGGACTGTGATCAGGGTGCCAACGGGGAGATAGCGTCTTTGAGCATCGTGGCTGGCGACCTC

CTTCAGCAGTTTAAAACAGTGAGGTCTTTCCCAGGGAGTAAAGCATTCAAAGTGAAAGCCGTCGGGGCCGTCGACTGGGACAGCCATCCTTACGGCTACA

ACCTGACATTGCAGGCTAAAGACAAAGGGACTCCTCCCCAGTTTTCCCCCGTGAAAGTTGTTCACATCATTTCTCCACAGTTCAGAGCTGGCCCTGTCAA

GTTTGAAATGGATGTTTACAGAGCCGAGATCAGTGAGTTTGCCCCTCCACATACACCCGTGGTCCTGGTCAAAGCCATTCCTAGTTATTCCCATTTGAGG

TATGTTTTTAAAAGCGCTCCTGGAAAACCTAAATTCGGTTTGAATCACAACACGGGTCTCATTTCCATTTTAGAACCCATTAGAAGGCAGCACACATCCC

ATTTTGAACTCGAGGTGACAACAAGTGACAAAAGAGCCTCCGCCCGAGTGGTGGTCAAAGTTTTAGGTACAAACAGCAACCCCCCTGAGTTTACACAGAC

CTCGTACAAAGCATCCATCGATGAGAACGCGCCTATCGGTGCCGCAGTCACGAGGGTGAGTGCGATGGACCCCGACGAGGGGGAGAATGGCTACGTGACT

TACAGTATTGCAAACTTAAATCACGTGCCGTTTGTCATTGACCACTTCACGGGAACCGTGAGTACCTCTGAGAATCTGGACTATGAACTGATGCCTCGCG

TGTACACGCTGAGGATCCGTGCGTCTGACTGGGGCTTGCCATACCGCCGGGAAGTCGAAGTCCTCGCCACGATTACTCTCAATAACCTGAATGACAACAC

ACCCCTGTTTGAGAGGATAAACTGTGAGGGGACCATTCCCCGAGACCTAGGTGTGGGGGAGCAGATAACCACCGTGTCTGCCATTGACGCCGACGAGCTG

CAGCTGGTCCGGTACCAGATTGAAGCCGGAAATGAGTTGGATTTGTTTGGCTTAAACCCCAGCTCCGGTGTGCTGTCCTTAAAGCACTCCCTCACGGATG

GCTTGGGCGCAAAGGTTTCCTTTCACAGTTTGAGAATCACAGCGACAGACGGAGAAAATTTTGCCACGCCGTTATACATCAACCTAACGGTGGCTGCCAG

TCGCAAGCCGGTCAACTTGCAGTGCGAGGAGACCGGTGTTGCCAAAATGTTGGCAGAGAAACTCCTGCAGGCGAATAAGTTACACAGTCAGGGGGACGTG

GAGGATATTTTCTTTGATTCTTACTCCGTCAATACCCATACTCCACAGTTCGGGGTTACTCTTCCAACTGGAATTGAGGTAAAGGAGAACCTCCCGGTGG

GTGCCAATATACTCTTCATGAATGCTACTGACCTTGACTCTGGCTTCAATGGAAAGCTCGTCTATGCTATTTCTGGAGGGAATGATGATAGTTGCTTTAC

CATCGACATGGAAACGGGAGTGCTGAAAGTCCTGTCTCCACTTGACCGTGAAGTAATGGACAAATACACCCTGAATATTACCGTGTACGACCTCGGTATA

CCCCAGAGGGCTGCCTGGCGCCTTCTGGACGTCACGGTTCTGGATGCCAATGACAATGCGCCCGAGTTTTTACAGGAGAGCTATTTTGTGGAAGTGAGTG

AAGACAAGGAGGTGAACAGTGAAATCATCCAGGTCGAAGCCACTGATAAAGATCTGGGCCCCAGCGGGCATGTGACCTACGCTATTCTCACAGATACGGA

GAAGTTTTCCATCGACAGCATGACCGGTGTGGTGAAAATTATCCAGCCTTTGGATCGTGAAGTGCAACCTGTGCATTACCTAAAGATCGAGGCCAGGGAC

CAAGCCACAGAGGAACCCCGGTTGTTCTCCACCGTGCTCCTGAAGGTGTCACTAGATGACGTTAATGACAACCCACCTAGGTTCATCCCACCCAATTACT

CAGTGAAAGTTCGAGAAGATCTACCAGAAGGAACCATCATCATGTGGTTAGAAGCCTATGATCCCGATGTGGGTCAGTCAAGTCAGGTGAGATACAGCCT

CCTGGATCACGGAGAAGGCCACTTTGATGTGGATAAACTCAGCGGCGCAGTTAGAATTGTCCAGCAGCTGGACTTTGAGAAGAAGCAACTGTATAATCTC

ACCGTGAGGGCCAAAGACAAAGGGAAGCCCGTGTCCCTGTCTTCCACTTGCTATGTGGAAGTGGAGGTCGTTGACGTGAATGAGAACCTACACACTCCGG

TGTTCTCCAGCTTTGTGGAGAAGGGTGTAGTGAAAGAAGACGTCCCTACTGGCTCATCAGTCATGACCGTGTCAGCTCACGACGAAGACACAGGCAGAGA

CGGAGAGATCCGGTATTCCATTAGAGATGGCTCTGGAATTGGTGTCTTCAGGATAGATGAAGAAACAG - UNI8594 - - UNI29579 - GTGTTA

TAGAGACTTCAGACCGACTGGATAGAGAGTCGACTTCCCACTACTGGCTCACGGTCTATGCCACAGATCAGGGCGTGGTGCCTCTGTCGTCCTTCATAGA

GGTCTACATAGAGGTGGAGGATGTCAATGACAACGCGCCACAGACATCAGAACCCGTGTACTATCCAGAAATCATGGAAAACTCACCCAAGGATGTATCT

GTGGTCCAGATTGAGGCTTTTGACCCGGATTCTAGCTCCAATGACAAACTGACATACAGAATTACAAGCGGGAACCCTCAAGGATTCTTCTCAATACATC

CTAAGACAG - UNI29574 - GTCTCATCACAACCACGTCGAGGAAGCTGGACCGAGAACAGCAGGACGAGCACATTCTAGAA GTTACTGTGACAGA

CAACGGTGTTCCCCCCAGATCCACCATTGCCAGAGTCATCGTGAAAATCCTCGATGAGAACGACAACAGGCCTCAATTCCTTCAGAAGTTTTACAAAATC

AGGCTCCCAGAGCGGGAAAAGGCGGACGGGGACCGGAGCGCTTCGAAGCGCGAGCCCCTCTACCGCGTCATAGCCGCGGATAAGGACGAGGGGCCCAATG

CGGAGCTCTCCTACAGCATCGAGGAAGGCAACGAGCACGGCAGGTTCTCCATCGAACCCAAAACGGGAGTGGTCTCGTCCAAAAAGTTTTCTGCGGCCGG

AGAATATGACATTCTTTCC ATTAAGGCAGTTGACAACGGGCGCCCCCAGAAGTCGTCCACCACCAGGCTCCATATCGAGTGGATCTCCAAACCCAAGCC

GTCCTCGGAGCCGATTTCGTTTGAGGAATCGGTTTTCTCATTTACCGTAATGGAAAGTGATCCGGTGGCTCACATGATCGGCGTGATCTCAGTTGAGCCC

CCTGGCATGCCTCTGTGGTTTGACATCATCG - UNI10254 - GTGGCAACTATGACAGCCACTTTGATGTGGACAAGGGCACCGGAACTATCATCGT

TGCTAAGCCCCTTGATGCAGAACAGAAATCCAGCTATAACCTCACCGTGGAGGCAACAGATGGGACCACCACGATCCTCACCCAG GTCCTCATCAAAGT

AATAGATACCAATGACCACCGCCCCCAGTTTTCTACATCGAAATACGAAGTTGCTGTTCCTGAGGACACAGAGCCAGAAGTGGAGATTCTGCAGATCAGT

GCAGTAGATAGGGATGAGAAAAACAAGTTGATCTACACTCTGCAGAGCAGCATCGATCCAGCCAGCCTCAAGAAATTCCGCCTCGATCCCGCAACAGGCG

CTCTTTACACTGCTGAAAAGCTTGACCATGAAGCCATTCACCAGCACGTTCTCACGGTCATG GTCCGGGATCAGGATGTCCCTGTGAAACGAAACTTTG

CCAGGATTGTTGTCAATGTCAGTGACAAGAATGACCACGCACCGTGGTTCACCAGTCCGTCCTACGACGGGCGGGTTTATGAATCGGCAGCCGTGGGCTC

AGTTGTGCTGCAAGTGACAGCTCTGGACAAAGACAAAGGGAGGAACGCTGAAGTGCTCTACTCGATCGAGTCAG - UNI9830 - GAAACATTGGAAA

TTCTTTTACAATTGACCCCATCTTGGGCTCTATAAAAACTGCCAGAGAATTGGACCGAAGTCACCAAGTAGATTATGATTTAATGGTAAAAGCTACAGAC

AAAGGCGATCCACCTATGAGCGAGATGACCTCCGTGCGTATCGCTGTCACTGTTGCTGACAATGCCTCTCCCAAGTTCACATCCAAAGAGTACTCTGCGG

AGATTAGTGAAGCCATCAGGATTGGAAGTTTTGTTGGGATGGTCTCTGCACACAGCCAGTCATCAGTGATGTATGAAATAAGAGACGGAAACATGGGCGA

CGCATTTAACATTAACCCGCATTCCGGAAGCATCATCACTCAGAGAGCCTTGGATTTTGAAACACTGCCCATGTATTCATTGACAGTGCAAGGGACCAAC

ATGGCCGGTTTGTCCACCAACACAACGGTGGTGGTGCACGTGCGGGATGAGAACGACAACCCGCCCGTTTTCACGCAGGCAGAATATTCAGGATTCATCA

GCGAGTCAGCCTCCGTCAACAGTGTGGTGCTGACAGACAGGAACGTTCCGCTGGTGATTCGAGCGACGGATGCTGACAGGGAATCCAATGCTCTGCTCGT

CTATCAAATCGTTGAGCCGTCCGTGCACAACTATTTTGCTATTGACCCCACCACCGGCGCCATCCGTACAGTGCTGAGTCTGGACTATGAAGAAACACAT

GCTTTTCACTTCACCGTCCAAGTGCACGACATGGGGACTCCTCGTCTGTTCGCCGAGTACGCAGCGAATGTGACTGTGCACGTGATCGACATCAACGACT

GCCCCCCTGTCTTCTCTAAGTCACTGTACGAAGTGTCTCTTCTCCTGCCGACATACAGAGGCGTGAACGTCATCACGGTGAACGCCACAGACGCTGACTC

CAAGGCATTCTCCCAGGTCATGTACTCCATCACTGAAGGCAACATTGGGGAGAAGTTCTCAATGGACCACAAGACTGGCACCATCGCAATACAGAACACG

ACTCAGCTACGAAGCCGCTATGAGCTGACCGTCCGCGCCTCCGACGGCAGGTTCACAAGCATGGCCTCCGTGAAAATCAACGTAAAGGAGAGCAGAGAGA

GTCCCCTCAAGTTTACCCAAGACGCCTACTCCGCAGTTGTGAAAGAGAACTCCACGGAAGCCAGAACGTTAGCTGTCATCACTGCGATAGGGAACCCACT

CAATGAGCCTTTGTTTTACCGCATCCTCAACCCAGACCGCAGATTTAAAATCAGCCACACGTCGGGCGTGTTGTCCACCACCGGGATACCGTTTGACCGT

GAGCAACAGGAGACGTTTGACGTGGTGGTAGAGGTGACTAAGGAACACGAGCCGTCAGCGGTGGCCCACGTCGTGGTGAAAGTCACCGTCGAAGACCAGA

ATGATAATGCTCCAGTGTTTGTTAACCTTCCCTACTACGCTGTGGTGAAGGTGGATGCTGAGGTGGGCCACGTCATTCGCTATGTTACTGCCATTGACAG

AGACAGTGGCAGAAATGGTGACATACACTACTACCTTAAGGAGCATCATGACCACTTCCAGATTGGACCTTCTGGCGACATTTCTCTGAAGAAGCAGTTT

GAGCATGACACTTTAAATAAAGAATACCTTGTCACAGTGGTCGCCAAGGACGGAGGGAGTCCAGCTTTCTCTGCAGAAGTTCTGGTTCCCATCACTGTCA

TGAACAAAGCCATGCCCGTGTTTGAAAAGGCTTTCTATAGCGCTGAGATCCCAGAGAACATCCAGATGCACAGCCCAGTGGTCCATATCCAAGCCAACAG

CCCAGAAGGGCTGAAAGTGTTCTACAGTATCACGGACGGAGACCCTTTTAGTCAGTTTACTATTAACTTCAACACTGGGGTGGTAAACGTCATAGCACCA

CTGGATTTTGAGTCCCACCCAGCCTATAAGCTAAGCGTGCGGGCAACTGACTCCCTGACGGGCGCTCACGCTGAAGTGTTTGTTGACATCATAGTGGAAG

ACATCAATGATAACCCTCCTGTGTTTGTGCAGCCATCTTACTCCACAACCCTGTCTGAAGCATCTGTAATTGGAACACCTGTCCTTCAAGTTCGAGCCAC

AGATTCCGACTCGGAACCAAACAGAGGAATTTCCTACCAGCTGATTGGAAATCACAGCAAAAGTCACGATCATTTTCACATAGATAGTAACACGGGGCTC

ATTTCACTAGTGAGAGCTTTGGATTACGAACAGTCCCAGCAGCACAGGATCTTCGTAAGGGCTGTTGATGGAGGGATGCCCGCCCTGAGCAGTGACGTGG

TCGTCACTGTGGCTGTCACCGACCTCAATGATAACCCACCTCTGTTTGAACAACAGGTTTATGAAGCCAGAATCAGCGAGCACGCCGCACACGGGCATTT

CGTGATGTGTGTGAGAGCCTGCGATGCAGACAGCTCAGACCTAGACAAGTTAGAGTACTCTATTCTGTCTGGCAATGATCATAAAAGCTTCATCATCGAC

AGGGAAACGGGAATTATCACGCTCTCCAACCTCCGCCGCCACACCCTGAAGCCGTTCTACAGCCTCAACGTTTCGGTGTCTGATGGGGTTTTCCGGAGCT

CGGCTCGGGTTAACGTAACTGTGATGGGAGGGAATTTGCACAGTCCTGTTTTTCACCAGAACGAATACGAAGTGGAGCTAGCTGAAAACGCTCCCTTGCA

CACCCTGGTGGTCCAAGTGAAGGCATCTGACAGAGATTCTGGCATTTACAGCCACGTAACTTACCACATTGTAAATGACTTTGCCAAAGACAGGTTTTAT

GTGAATGACAGAGGGCAGATTTTCACTTTGGAGAAACTTGACCGAGAGACACCGGCGGAGAAAGTGATCTCGATCCGCTTGATGGCTAAGGATGCTGGGG

GGAAGGTTGCTTTCTGCACCGTCAATGTCATCCTCACAGACGACAATGACAACGCACCTCAGTTTCGCTCAACCAAGTACGAGGTGAACATCGGGTCCAG

CGCTGCCAAAGGGACGTCGGTCGTCAAGGTCTTTGCGAGTGACGCTGATGAGGGATCGAATGCTGACGTCACCTACGCCATTGAGGCGGATTCTGAAAGT

GTCAAGGAGAACTTGGAAATCAACAAGCTGACTGGCCTGATTACTACAAAGGAAAGTTTAATAGGTTTAGAGAATGAGTTCTTCACTTTCTTCGTTAGAG

CCGTGGATAGCGGGTCTCCGCCCAGAGAGTCTGTCGTTCCTGTCTATATTAAAATACTTCCACCAGAAGTGCAGCTTCCTAGGTTCTCAGAGCCCTTTTA

TACCTATACCATCTCAGAAGACACGCCCATTGGAACAGAAATTGACCTCATCCGGGTAGAACATGGCGGGGCTGTTCTTTACATCCTTGTCAAAGGCAAT

ACTCCTGAGAGTAATCGAGATGAGTTCTTTGTGATCGACAGGCAGAATGGGAGACTGAAACTGGAGAAGAGCCTTGACCATGAGACCACTAAGTGGTATC

AGTTTTCCATCCTGGCCAGATGCACTCTTGATGACTACGAGGTGGTGGCTTCTATAGATGTCAGTATCCAGGTGAAAGATGCTAATGATAACAGCCCAGT

TTTGGAGTCCAGTCCCTATGAGGCATTTATTGTTGAAAACCTGCCAGGGGGAAGCAGGGTCATCCAGATCAGAGCATCTGACCTAGACTCAGGAGCCAAC

GGCCAAGTCATGTACAGCCTAGACCAATCCCAAGACGCAGACATCATCGAATCTTTTGCCATTAACATGGAAACAGGCTGGATTACAACTCTCAAGGAGC

TTGACCACGAAGAGAGGGCCAGTTACCAGATTAAAGTGGTCGCGTCGGATCACGGTGAGAAGGTGCAGCTGTCTTCCACCGCCATTGTGGGTGTTACCGT

CACTGACGTCAACGACAGCCCGCCGAGATTCACGGCTGAGATTTACAAAGGGACGGTGAGTGAGGATGACCCTCCAGGTGGCGTGATCGCCATCTTAAGC

ACGACCGATGCTGACACTGAAGAGATCAACAGACAGGTGTCATACTTCATCACAG GAGGGGATGCCTTGGGACAGTTTGCTGTGGAAAATGTGCAGAGT

GACTGGAGGGTGTATGTGAAGAAGCCCCTCGACAGGGAACAAAAGGATAGTTACCTTCTGACTGTCACAGCAACAGACGGGACCTTCTCTTCCAAAGCTA

GAGTTGAAGTCAAAGTTCTCGATGCCAACGACAACAGTCCAGTCTGTGAGAAG ACCTCGTATTCTGATACCATTCCTGAAGACGCCCTTCCCGGGAAGC

TGGTCATGCAGGTCTCTGCCACAGACGCGGATATCCGGTCCAACGCAGAGATTACTTACACTTTATTTGGTTCAGGTGCAGAGAAGTTTAAACTGAATCC

AGACACAG GTGAACTGAGAACACTAGCCCTCCTTGATCGTGAGGAACAAGCAGTTTATAATCTTCTAGTCAAGGCCACGGACGGAGGTGGGAGGTCCTG

TCAGGCGGCTATTGTGCTCACGTTAGAAGATGTGAACGATAATGCTCCTGAGTTCACCGCGGAGCCCTACACCATCACGGTATTCGAGAACACAGAGCCT

GGGACACCGCTGACCAGAGTGCAGGCCACTGATGCAGACACAG GATTGAATCGGAAGATTTCCTACTCGCTGGTCGAATCCGCTGACGGGCAGTTCTCC

ATTAATGAGAGATCTGGAATTATCCAGTTGGAAAAGCATTTGGACAGGGAACTACAGGCAGTCTATACTCTCACTTTGAAAGCAGTGGACCAAGGATTGC

CAAGGAGATTGACAGCTACTGGCACGGTGGTTGTGTCTGTTTTGGATATAAACGACAACCCGCCAGTGTTTGAGTACCGTGAATATGGCGCCAGTGTGTC

TGAGGACATTGTCATTGGGACGGAGGTTCTCCAGGTGTACGCCGCAAGTCGGGATATCGAGGCCAACGCGGAAATCACCTACGCCATCATAAGTGGAAAT

GAACATGGAAAATTCAGCATCGATTCTAAGACAG - UNI10257 - GGGCCATATTTATCATTGAGAGCCTGGATTATGAAAGCTCCCACGAGTATTA

CCTGACCGTGGAAGCCACTGATGGAGGCACGCCTTCGTTGAGTGATGTGGCGACCGTGAACATCAACGTCACAGACATCAACGATAACAGCCCCGTGTTC

AGCCAAGACACCTACACCACCGTGGTCAGTGAGGATGCGGCTCTCGAGCAGCCTGTCATTACG - UNI8927 - ATTATGGCTGACGATGCTGATGGC

CCCTCAAACAGCCACATCCACTACTCCATTATAGAGGGGAACCAGGGAAGTCCGTTCACAATTGACCCTGTCAGAGGAGAAGTGAAAGTGACGAAGCCCC

TAGACCGGGAAACG - UNI8927 - ATCTCAGGTTATACACTCACGGTGCAAGCTGCCGACAACGGCAATCCACCCAGAGTCAACACAACCACGGTGA

ATATCGATGTCTCCGATGTCAATGACAACGCTCCCCTCTTCTCCAGAGACAACTACAGTGTCATCATCCAG GAGAACAAACCCGTGGGTTTCAGCGTTC

TGAAGCTGGTAGTGACAGACAAGGACTCTTCCCACAACGGTCCCCCCTTCTTCTTCACTATTGTGAGTGGAAATGATGAAAACGCCTTTGAGGTGAATCA

GCATGGGGTCCTCCTGACAGCGGCGACGATCAAGAGGAAAGTGAAGGACCATTACCTTCTGCATGTTAAG GTGGCTGACAGCGGAAAGCCTCAGCTGTC

ATCCATGACACACATTGACATCAGGGTGATCGAGGAAAGCATCCACCCTCCTGCCATCTTGCCGCTGGAGATTTTCATCACCGCCTTTGGAGAGGAATAC

TCAGGTGGGGTCATAGGAAAGATCCACGCCACCGACCAGGACGTGTATGACACCTTGATGTACAGTCTGGATCCCCACATGGATGGCCTGTTCTCTGTCT

CCAGCACGGGGGGCAAGCTGATTGCACACAGAAAGCTGGACATAGGCCAGTACCTTCTCAATGTCAGCGTGACAGATGGGAAATTCACCACGGTGGCCGA

CATCACCGTGCACATCCAACAAGTGACCCAGGAGATGCTGAACCACACCGTCGCCATTCGCTTCGCGAATCTCACCCCGGAGGAGTTTGTTGGTGACTAC

TGGCGCAACTTCCAGCGAGCCCTACGCAACATCCTGGGCGTCCGGAAGAATGACATACAGATCGTCAGCCTGCAGCCCTCCGAACCCCATTCGCATCTGG

ACGTCTTACTCTTTGTCGAGAGGTCAGGCGGCACCCACGTTTCAACAAAGCAACTTCTGCATAAGATTAATTCTTCCGTGACGGACGTTGAGGAAATCAT

TGGCGTGAGGATCCTGGAAGTGTTCCAGAAGCTCTGTGCGGGGCTGGATTGCCCGTGGAAGTTCTGTGATGAGAAGGTGTCTGTGGATGAAAACGTCATG

TCCACTCACAGCACGGCCAGACTGAGTTTCGTGACTCCCCGACACCACAGAACAGCAGTGTGTCTCTGCAAAG ACGGGACATGCCCACCTGTCCACCAT

GGGTGTGAAGATAACCCCTGTCCCGCGGGATCTGAGTGTGTCGCGGATCCCCGAGAGGAGAAGTATAGCTGCGTGTGCCCCGGGGGCGGCTTCGGTAAAT

GCCCAG GGAGCTCATCTATAACTTTCACGGGAAACAGCTTCGTGAAGTACCGCCTGCTGGAGAATGAGAACAGACTGGAGATGAAGCTGAGCATGCGTC

TGAGAACCTACTCCTCCCACGCGGTTGTCATGTACGCGCGAGGGACTGACTACAGCATC CCTGGGATTGTCTCCGTCCAGAGCATTCAGGTCAACGACG

GGCAGTGGCACGCGGTGTCCCTGGAAGTGGAGGGCAATTACGCCAAGCTGGTTCTGGATGAAGTCCACACCGCTTCGGGCACAGCCCCGGGGGCTCTGAA

AACCCTCAACCTGGACAACTACGTCTTTTTTGGTGGCCACCTCCGCCAGCAAGGGACAAAGCATGGGCGAGGCGCCCAGGTGGCCAGTGGCTTCAGGGGC

TGCATGGATTCTATTTATTTGAACGGGCAGGAGTTGCCTCTGAACAACAAGCCAAGAGCCTACGCGCACATCGAAGAGTGGGTGGACCTATCTCATGGAT

GCTTATTGACCGCCACAGAAGACTGCTCCAGCAGCCCCTGTCAGAATGGAGGCGTTTGCAATCCCTCGCCTACTGGAG GTTATTACTGCAAGTGCAGCG

CGTTGTACGTAGGGACGTTCTGTGAGGTGAGCGTCAACCCGTGCTCCTCCAACCCCTGCCTCTACGGAGGAACGTGCATGGTAGACAACGGCGGCTTTGT

GTGCCAGTGCAGGGGGCTGTACACTG - UNI11178 - GGCTTGTTTTGTTTTTTTCTTTTTGCATGTGTTTTTCCTTATTTAGATGTCAGCTTAGTC

CGTACTGCAAAGATGATCCCTGTAAGAATGGTGGAACGTGTTTTGACAGTTTGGATGGTGCTGTCTGTCAGTGTGACTCAGGCTTTAGGGGAGAAAG AT

GTCAGAGTGACATCGATGAGTGTGCTGGGAACCCCTGTCGGAACGGGGCCCTTTGCGAGAACACACACGGCTCCTATCACTGTAACTGCAGCCAGGAGTA

CAGAGGGAAGCACTGTGAGGATGCCTCTCCCAACCACTACGTGTCCACCCCGTGGAACATCGGACTGGCCGAGGGAATAGGTATTATTGTGTTTATAGCT

GGGATAGTCTTACTAGTGATGGTGTTCGTCCTCTGCCGGAAGATGATCAGTCGGAAGAAGAAGCGCCAGGCTGAACCTGAAGACAAACGTTTGGGGCCAA

CCACGGCTTTCTTGCAGAGACCTTATTTTGATTCAAAGCTGAACAAGAACATTTACTCCGACATCCCGCCCCAGGTGCCGGTCCGTCCCATTTCCTACAC

TCCCAGCATTCCAAGCGACTCGAGAAACAACCTTGACCGCAATTCCTTCGAAGGCTCCGCGATCCCAGAGCATCCAGAATTCAGCACCTTCAACCCCGAG

TCTATGCACGGGCATCGAAAAGCCGTGGCTGTGTGCAGCGTAGCTCCAAACTTGCCTCCACCGCCGCCTTCCAACTCGCCCTCAGACAGCGACTCCATAC

AGAAGCCTAGCTGGGACTTTGACTACGACG CTAAAGTGGTAGATCTGGATCCCTGTCTCTCTAAGAAGCCCCTGGAGGAAAAGCCCTCCCAGCCATACA

GTGCCCGGGAGAGCCTGTCTGAGGTGCAGTCGCTTAGCTCCTTCCAGTCAGAGTCCTGTGATGACAATG - UNI6262 - AATCTTTGGCTGCTCCTG

ACCTCAGCAAACCAAGAG GGTACCACTGGGATACATCAGACTGGATGCCAAGTGTCCCTCTGCCAGACATACAAGAGTTCCCCAATTACGAGGCTATTG

ACGAACACACACCCCTCTACTCGGCTGATCCAAACGCCATCGATACTGACTATTACCCTGGGGGTTATGACATTGAAAGTGACTTTCCACCCCCACCAGA

GGACTTCCCTGCACCCGATGAACTGCCACCATTGCCTCCAGAGTTCAGCGACCAGTTCGAGTCCATACACCCACCCAGGGACATGCCTGCAGCAGGTAGC

TTGGGATCTTCCTCCCGGAGTCGGCAGAGGTTCAACCTGAATCAGTACCTGCCCAATTTCTACCCCGCCGATATGTCCGAACCTCAGAAACAAGGCGCTG

GCGAGAACAGTCCATGTAGAGAACCCTACACCCCCTACCCCCCAGGGTATCAAAGAAACTTCGAAGCGCCCACCATAGAAAACATGCCCATGTCCGTGTA

CGCCTCGACGGCTTCCTGCTCCGACGTGTCAGCGTGCTGTGAAGTGGAGTCTGAGGTCATGATGAGCGACTACGAGAGCGGGGACGACGGCCACTTCGAA

GAGGTGACGATCCCTCCGCTAGATTCCCAGCAGCATACGGAAGTGTGACGCTCAAACTCCTCCCCAAAGTGCCTGGACTTTCATGAACCTAGAGATGCTA

TCGGTGACATCCGCCGTTGTGTTGTTCTTTTGCAGCCGTCTGGGCCGCTTCTCGGTGAGCCGCGGTAGGCGTGGCTGCACGGAGTCACAAGCCTCTTGAC

ATGTTAGCCATTTCCAGCGTCCTAACTGACTGTAATCGACCGGGTTTTCATCCCCTGTCCCATCCCCTGAGCATCTTTTCGTATTTAGATTTGTCTCTGT

TAAAATGATGAAACGGAAATCGGTCCTGTCGTCTTGTTAGCATGATTCATGTATTTATATAGATCCGATTATTTTAATTTTTGCTTTCTTTGTGTAAATT

TTATGTACAGATTTGATTTTTTGTTTTTTTTTGTTTGTTTGTTTGTTTTCCCCCCTCTCCTAGTTTTTACCTAGGTTTTCAGGACGCCTCGTGTTTTTGT

TTTCTGCTGGATCTGTGTGGTGGTGTTAGCGTCGTTTGCCTAGCATCTGATTTTCTGATGTAACCAGGGTTTCACGCTGTTCTTTTCCTCTGAAGTATGA

CATTTCATTGACACATTTCGGTCCAGTGTAGCTGTACATATGGGGTGTGGACGACCTGTTACTGGACATGTCTTATTAAATGGGTTGCTGTATTAGGATT

ATAAACATTTTTCATTATTGGAAAGTGTGAAGGGGACCTTCTGCATACCTGTTTAGAACCAAAACCACCACGACACGGTTTTTATAGTGTCTGTATATTT

GTGATGCAATGGTCTTGTAAAGGTTTTTACTGAAAACTATCATTAGCCAGCCTTTCTTACTGACAATAAATTATTAATAAAATACTTTAGCTTTAA
Translation
MGRHLTLLLLLLLFLQQFGDSDGSQRLEPTPPIQFTHFQYNVTVHENSAAKTYVGHPRKMGIYILDPSWEIRYKIVSGDSENLFKAEEYVLGDFCFLRIR

TKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDVFAIHP

TSGVVVLTGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDL

LQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHLR

YVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSDKRASARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVT

YSIANLNHVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADEL

QLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDV

EDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGI

PQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARD

QATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNL

TVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETG - UNI8594

 - - UNI29579 - GVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSND

KLTYRITSGNPQGFFSIHPKTG - UNI29574 - GLITTTSRKLDREQQDEHILE VTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPE

REKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGEYDILS IKAVDNGRPQKSSTTRLHIEWISKPKPSSE

PISFEESVFSFTVMESDPVAHMIGVISVEPPGMPLWFDIIG - UNI10254 - GGNYDSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATDGTTTIL

TQ VLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDEKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVM VRDQ

DVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESG - UNI9830 - GNIGNSFTIDPILGSIKTAR

ELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHSQSSVMYEIRDGNMGDAFNINPHSGSIITQR

ALDFETLPMYSLTVQGTNMAGLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESNALLVYQIVEPSVHNYFAID

PTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNI

GEKFSMDHKTGTIAIQNTTQLRSRYELTVRASDGRFTSMASVKINVKESRESPLKFTQDAYSAVVKENSTEARTLAVITAIGNPLNEPLFYRILNPDRRF

KISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHVIRYVTAIDRDSGRNGDIHYYLKEH

HDHFQIGPSGDISLKKQFEHDTLNKEYLVTVVAKDGGSPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENIQMHSPVVHIQANSPEGLKVFYSITDGDP

FSQFTINFNTGVVNVIAPLDFESHPAYKLSVRATDSLTGAHAEVFVDIIVEDINDNPPVFVQPSYSTTLSEASVIGTPVLQVRATDSDSEPNRGISYQLI

GNHSKSHDHFHIDSNTGLISLVRALDYEQSQQHRIFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEARISEHAAHGHFVMCVRACDADSSDLD

KLEYSILSGNDHKSFIIDRETGIITLSNLRRHTLKPFYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKASDRDSGI

YSHVTYHIVNDFAKDRFYVNDRGQIFTLEKLDRETPAEKVISIRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRSTKYEVNIGSSAAKGTSVVKVFASDA

DEGSNADVTYAIEADSESVKENLEINKLTGLITTKESLIGLENEFFTFFVRAVDSGSPPRESVVPVYIKILPPEVQLPRFSEPFYTYTISEDTPIGTEID

LIRVEHGGAVLYILVKGNTPESNRDEFFVIDRQNGRLKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESSPYEAFIVENLP

GGSRVIQIRASDLDSGANGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEERASYQIKVVASDHGEKVQLSSTAIVGVTVTDVNDSPPRFTAEIY

KGTVSEDDPPGGVIAILSTTDADTEEINRQVSYFITG GGDALGQFAVENVQSDWRVYVKKPLDREQKDSYLLTVTATDGTFSSKARVEVKVLDANDNSP

VCEK TSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEKFKLNPDTG GELRTLALLDREEQAVYNLLVKATDGGGRSCQAAIVLTLEDV

NDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTG GLNRKISYSLVESADGQFSINERSGIIQLEKHLDRELQAVYTLTLKAVDQGLPRRLTATGTV

VVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTG - UNI10257 - GAIFIIESLDYESSHEY

YLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVIT - UNI8927 - IMADDADGPSNSHIHYSIIEGNQGSPFTIDPV

RGEVKVTKPLDRET - UNI8927 - ISGYTLTVQAADNGNPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQ ENKPVGFSVLKLVVTDKDSSHNGP

PFFFTIVSGNDENAFEVNQHGVLLTAATIKRKVKDHYLLHVK VADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYSGGVIGKIHATDQD

VYDTLMYSLDPHMDGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTVAIRFANLTPEEFVGDYWRNFQRALRNILGV

RKNDIQIVSLQPSEPHSHLDVLLFVERSGGTHVSTKQLLHKINSSVTDVEEIIGVRILEVFQKLCAGLDCPWKFCDEKVSVDENVMSTHSTARLSFVTPR

HHRTAVCLCKD DGTCPPVHHGCEDNPCPAGSECVADPREEKYSCVCPGGGFGKCPG GSSSITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVM

YARGTDYSI PGIVSVQSIQVNDGQWHAVSLEVEGNYAKLVLDEVHTASGTAPGALKTLNLDNYVFFGGHLRQQGTKHGRGAQVASGFRGCMDSIYLNGQ

ELPLNNKPRAYAHIEEWVDLSHGCLLTATEDCSSSPCQNGGVCNPSPTGG GYYCKCSALYVGTFCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCRGLYT

G - UNI11178 - GLVLFFSFCMCFSLFRCQLSPYCKDDPCKNGGTCFDSLDGAVCQCDSGFRGER RCQSDIDECAGNPCRNGALCENTHGSYHCNC

SQEYRGKHCEDASPNHYVSTPWNIGLAEGIGIIVFIAGIVLLVMVFVLCRKMISRKKKRQAEPEDKRLGPTTAFLQRPYFDSKLNKNIYSDIPPQVPVRP

ISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESMHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFDYDA AKVVDLDPCLSKKPLEEK

PSQPYSARESLSEVQSLSSFQSESCDDNE - UNI6262 - ESLAAPDLSKPRG GYHWDTSDWMPSVPLPDIQEFPNYEAIDEHTPLYSADPNAIDTD

YYPGGYDIESDFPPPPEDFPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRSRQRFNLNQYLPNFYPADMSEPQKQGAGENSPCREPYTPYPPGY

QRNFEAPTIENMPMSVYASTASCSDVSACCEVESEVMMSDYESGDDGHFEEVTIPPLDSQQHTEV

For any suggestions or comments, please send an email to unitrap@crg.es