Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070291 (RP23-366K1.1)
Chromosomal location
Chr 9: 78243584 - 78271394 (+)
Description
not available
UniGene
Mm.158166 
Human Ortholog
ENSG00000080007 (DDX43)
Omim not available
UniTrap UNI19934
Vector Insertion
Chr 9: 78243934 - 78246847
Public Clones not available
Private Clones OST376763 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25176
Vector Insertion
Chr 9: 78248783 - 78250156
Public Clones not available
Private Clones OST192850 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093814
Sequence
ATGCAAACAAAAGCAAAAACAGTGATAGATAATGTTGTTAAAAAACAACAAAATTACATTCCAGGACAAAGAGTTG - UNI25176 - GTATTATTGC

ATTCCAACCTACCGTTGGAGCAGATACCAGCACAAGTGAGAGTGTAACAGACGATCAGCCATTGATAGATTGGGATCAAATTCGAGAAGATGCTTTGAAA

TGGGAAAAGAAAAAGTGGGCAG ATTTACCTCCAATTAAGAAAAACTTTTACATAGAGTCAGCAACGACAAGCTCAATGTCACAAGTGCAAATAGACAAC

TGGAG GAAAGAAAATTTTAATATAACATGTGATGACTTGAAAGATGGTGAGAAGCGTCCTATCCCCAACCCTATATGTAAATTTGAAGATGCCTTTCAA

AGTTACCCAGAAGTAATGGAAAACATTAAAAGAGCAGGCTTTCAAAAACCTACACCGATTCAG TCACAGGCATGGCCAATAGTTCTACAAGGAATAGAT

CTTATTGGAGTAGCACAAACTGGAACAGGGAAGACACTGTCCTATTTAATGCCTGGATTTATTCATCTAGACTCTCAACCACT AGCTAGAGAACAAAGA

AATGGGCCTGGCATGTTAGTTCTTACGCCCACCCGGGAATTAGCCCTTCAAGTAGAAGCTGAATGTTCTAAATATTCATATGGTGATCTTAAAAG TGTT

TGTGTATATGGTGGTGGTGATAGAGATGGACAAATACAAGATGTTTCAAAAGGTGTAGACATCATTATTGCAACTCCTGGAAGATTGAATGACCTACAAA

TGAATAACTTTGTCAATCTGAAAAGTGTAACCTATTTG GTTTTAGATGAAGCAGACAAGATGCTGGACATGGGATTTGAACCCCAGATAATGAAGATTT

TGTTAGATGTACGCCCAGACCGGCAGACTATTATGACAAG CGCTACTTGGCCATATGCCGTCCGCCGTCTTGCACAATCTTATTTGAAAGAACCAATGA

TTGTCTATGTTGGTACTTTGGATCTAGTT GCTGTAAGTACAGTGAAACAAAATATAATCATTACCACAGAAGAAGAGAAACGAACTCATATCCAGACCT

TCCTCGAGAATATGTCACCTAAAGACAAAGTCATTGTCTTTGTCAGCAGAAAAGCCGT TGCTGATCACTTATCAAGTGATCTGATTCTCCGACACATAT

CAGTGGAGTCTCTGCACGGCAACAGAGAACAGAGTGACCGAGAGAAAGCGTTAGAGAACTTTAAGACAG GTAAAGTGAGAATACTTATTGCTACTGACT

TGGCATCTCGAGGTCTTGATGTCCATGATATCACTCATGTCTACAATTATGATTTTCCACGGAACATTGAAGAATATGTACACAGAGTAGGGCGCACTGG

GAGAGCAGG GCGCACTGGAATGTCAATTACCCTTATCACAAGAAATGATTGGAGGGTTGCCACTGAATTGATTAATATTCTAGAAAGAGCAAATCAG A

ATATCCCAGAGGAACTTGTCTTAATGGCTGAGAGATACAAAGCAAATAAACTAAAAAGAGAGATGGAAAAAAAAATGGGAAGACCTCAAGGAAAGCCCCA

GAAGTTTTACTAATGTTGCGTGGAGCACTAGGTGCCGCAG GATTCAAGATTGTAGTCAAAGTGGAAGTGTTGAAACATACGTCACTATGGAGAGACTTG

GCTGATTCTTAAAATAATAGTGTGTTAAAATGTAGAATTCAATGTTTTATACTTTCTTTAATAAAACAGTAGTTTTT
Translation
MQTKAKTVIDNVVKKQQNYIPGQRVG - UNI25176 - GIIAFQPTVGADTSTSESVTDDQPLIDWDQIREDALKWEKKKWAD DLPPIKKNFYIESA

TTSSMSQVQIDNWR RKENFNITCDDLKDGEKRPIPNPICKFEDAFQSYPEVMENIKRAGFQKPTPIQ SQAWPIVLQGIDLIGVAQTGTGKTLSYLMPG

FIHLDSQPL LAREQRNGPGMLVLTPTRELALQVEAECSKYSYGDLKS SVCVYGGGDRDGQIQDVSKGVDIIIATPGRLNDLQMNNFVNLKSVTYL VL

DEADKMLDMGFEPQIMKILLDVRPDRQTIMTS SATWPYAVRRLAQSYLKEPMIVYVGTLDLV AVSTVKQNIIITTEEEKRTHIQTFLENMSPKDKVIV

FVSRKAV VADHLSSDLILRHISVESLHGNREQSDREKALENFKTG GKVRILIATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAG GRTGM

SITLITRNDWRVATELINILERANQ NIPEELVLMAERYKANKLKREMEKKMGRPQGKPQKFY 
Transcript ENSMUST00000113367
Sequence
GGACTGGCGGGCGAGCTCGCGGGCGGCAGCGGAGTTTTTCCGACGCCGCGGCCTGTGCAGCTGAGTCTGGAACGACGTGCGACGCGCGGCTCTCCTCAGA

GCCATGTCTAGGCGGGAACCCGCAGCCAACGCTTCCTCCTCGGGCGTTGCTCCCCGGCGAAGCTCGACCGGGTCCCGGGGCGCCGACCGGACAGCGACGG

AGGAGACGAACCGGAGAGGCCGGGTCGGTAGCAGGGGTGCGGGCGGCGGCTGGAGAGAGCCCGCCGGGGCCGCCGAGGCTACGGCCGCCGGCCGCCGCGA

ACCGCCGCTCTGCTTCGGGGTGAAGAACGATGTGGTGGGCGCGGTGATAG - UNI19934 - GTCGTGGTGGGTCAAAAATTAGAGAAATCCAAAATA

CAACGAACACTAGGATACAG GTAATAAAAGGAAATCCTGAGGCAGAAATCAAAATTTTTGGTAATAAAGCCATGCAAACAAAAGCAAAAACAGTGATAG

ATAATGTTGTTAAAAAACAACAAAATTACATTCCAGGACAAAGAGTTG - UNI25176 - GTATTATTGCATTCCAACCTACCGTTGGAGCAGATACC

AGCACAAGTGAGAGTGTAACAGACGATCAGCCATTGATAGATTGGGATCAAATTCGAGAAGATGCTTTGAAATGGGAAAAGAAAAAGTGGGCAG ATTTA

CCTCCAATTAAGAAAAACTTTTACATAGAGTCAGCAACGACAAGCTCAATGTCACAAGTGCAAATAGACAACTGGAG GAAAGAAAATTTTAATATAACA

TGTGATGACTTGAAAGATGGTGAGAAGCGTCCTATCCCCAACCCTATATGTAAATTTGAAGATGCCTTTCAAAGTTACCCAGAAGTAATGGAAAACATTA

AAAGAGCAGGCTTTCAAAAACCTACACCGATTCAG TCACAGGCATGGCCAATAGTTCTACAAGGAATAGATCTTATTGGAGTAGCACAAACTGGAACAG

GGAAGACACTGTCCTATTTAATGCCTGGATTTATTCATCTAGACTCTCAACCACT AGCTAGAGAACAAAGAAATGGGCCTGGCATGTTAGTTCTTACGC

CCACCCGGGAATTAGCCCTTCAAGTAGAAGCTGAATGTTCTAAATATTCATATGGTGATCTTAAAAG TGTTTGTGTATATGGTGGTGGTGATAGAGATG

GACAAATACAAGATGTTTCAAAAGGTGTAGACATCATTATTGCAACTCCTGGAAGATTGAATGACCTACAAATGAATAACTTTGTCAATCTGAAAAGTGT

AACCTATTTG GTTTTAGATGAAGCAGACAAGATGCTGGACATGGGATTTGAACCCCAGATAATGAAGATTTTGTTAGATGTACGCCCAGACCGGCAGAC

TATTATGACAAG CGCTACTTGGCCATATGCCGTCCGCCGTCTTGCACAATCTTATTTGAAAGAACCAATGATTGTCTATGTTGGTACTTTGGATCTAGT

T GCTGTAAGTACAGTGAAACAAAATATAATCATTACCACAGAAGAAGAGAAACGAACTCATATCCAGACCTTCCTCGAGAATATGTCACCTAAAGACAA

AGTCATTGTCTTTGTCAGCAGAAAAGCCGT TGCTGATCACTTATCAAGTGATCTGATTCTCCGACACATATCAGTGGAGTCTCTGCACGGCAACAGAGA

ACAGAGTGACCGAGAGAAAGCGTTAGAGAACTTTAAGACAG GTAAAGTGAGAATACTTATTGCTACTGACTTGGCATCTCGAGGTCTTGATGTCCATGA

TATCACTCATGTCTACAATTATGATTTTCCACGGAACATTGAAGAATATGTACACAGAGTAGGGCGCACTGGGAGAGCAGG GCGCACTGGAATGTCAAT

TACCCTTATCACAAGAAATGATTGGAGGGTTGCCACTGAATTGATTAATATTCTAGAAAGAGCAAATCAG AATATCCCAGAGGAACTTGTCTTAATGGC

TGAGAGATACAAAGCAAATAAACTAAAAAGAGAGATGGAAAAAAAAATGGGAAGACCTCAAGGAAAGCCCCAGAAGTTTTACTAATGTTGCGTGGAGCAC

TAGGTGCCGCAG GATTCAAGATTGTAGTCAAAGTGGAAGTGTTGAAACATACGTCACTATGGAGAGACTTGGCTGATTCTTAAAATAATAGTGTGTTAA

AATGTAGAATTCAATGTTTTATACTTTCTTTAATAAAACAGTAGTTTTT
Translation
MSRREPAANASSSGVAPRRSSTGSRGADRTATEETNRRGRVGSRGAGGGWREPAGAAEATAAGRREPPLCFGVKNDVVGAVIG - UNI19934 - GRG

GSKIREIQNTTNTRIQ VIKGNPEAEIKIFGNKAMQTKAKTVIDNVVKKQQNYIPGQRVG - UNI25176 - GIIAFQPTVGADTSTSESVTDDQPLI

DWDQIREDALKWEKKKWAD DLPPIKKNFYIESATTSSMSQVQIDNWR RKENFNITCDDLKDGEKRPIPNPICKFEDAFQSYPEVMENIKRAGFQKPTP

IQ SQAWPIVLQGIDLIGVAQTGTGKTLSYLMPGFIHLDSQPL LAREQRNGPGMLVLTPTRELALQVEAECSKYSYGDLKS SVCVYGGGDRDGQIQDV

SKGVDIIIATPGRLNDLQMNNFVNLKSVTYL VLDEADKMLDMGFEPQIMKILLDVRPDRQTIMTS SATWPYAVRRLAQSYLKEPMIVYVGTLDLV AV

STVKQNIIITTEEEKRTHIQTFLENMSPKDKVIVFVSRKAV VADHLSSDLILRHISVESLHGNREQSDREKALENFKTG GKVRILIATDLASRGLDVH

DITHVYNYDFPRNIEEYVHRVGRTGRAG GRTGMSITLITRNDWRVATELINILERANQ NIPEELVLMAERYKANKLKREMEKKMGRPQGKPQKFY 

For any suggestions or comments, please send an email to unitrap@crg.es