Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070372 (Capza1)
Chromosomal location
Chr 3: 104625855 - 104667312 (-)
Description
capping protein (actin filament) muscle Z-line, alpha 1 Gene [Source:MGI (curated);Acc:Capza1-001]
RefSeq_dna
NM_009797 
RefSeq_peptide
NP_033927.2 
UniGene
Mm.19142 Mm.410636 Mm.475869 
MGI
MGI:106227 
Uniprot/SWISSPROT
P47753 
Uniprot/SPTREMBL
Q3TLJ0 Q3UAS2 Q3UJV2 Q5RKN9 Q99L12 
Human Ortholog
ENSG00000116489 (CAPZA1)
Omim not available
UniTrap UNI7213
Vector Insertion
Chr 3: 104647900 - 104667257
Public Clones (sanger) RRF224 (baygenomics) RRS104 (baygenomics) RRH244 (baygenomics)
RRU586 (baygenomics) IST10488E9 (tigm) IST14518C6 (tigm) IST13551F7 (tigm)
Private Clones OST457812 (lexicon) OST437661 (lexicon) OST422360 (lexicon) OST352227 (lexicon)
OST329037 (lexicon) OST288939 (lexicon) OST262548 (lexicon) OST198105 (lexicon)
OST151345 (lexicon) OST64303 (lexicon) OST64302 (lexicon) OST57019 (lexicon)
OST40496 (lexicon) OST38853 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000094028
Sequence
GGCCAGAGCAGCCAAGATGGCCGACTTTGAGGATCGGGTGTCGGATGAAGAGAAG - UNI7213 - GTCCGCATAGCCGCTAAATTCATCACCCATGC

ACCCCCAGGGGAGTTTAATGAAGTATTCAATG ATGTCCGGCTACTGCTTAACAATGACAATCTCCTCAGGGAAGGGGCAGCACA TGCATTTGCCCAGT

ATAACATGGATCAGTTCACACCCGTGAAGATAGAAGGCTACGATGACCAG GTCTTAATTACAGAGCATGGTGACCTTGGTAACAGCAGATTTTTAGATC

CAAGAAACCAAATTTCCTTTAAGTTTGATCATTTACGGAAAGAAGCAAGTGACCCGCAGCCAGAGGATGTGGATGGAGGCTTGAAGTCTTGGAGGGAGTC

GTGTGACAGTGCTCTGAGAGCCTATGTGAAAGATCATTATTCCAACGGCTTCTGTACT GTTTACGCTAAAACTATAGATGGGCAACAGACCATTATTGC

ATGTATTGAAAGCCACCAGTTTCAACCAAAAAACTTCTG GAATGGTCGCTGGAGATCAGAGTGGAAGTTCACCATTACACCACCTTCAGCCCAGGTGGT

TGGAGTACTCAAGATTCAG GTTCATTATTATGAAGATGGCAATGTTCAGCTGGTTAGTCATAAAGATGTGCAGGACTCAGTAACTGTTTCT AATGAAA

TCCAAACTACCAAGGAGTTTATTAAAATCATAGAGAGTGCAGAAAATGAGTATCAG ACAGCAATTAGTGAAAATTACCAAACTATGTCAGACACCACGT

TCAAGGCCTTGCGCCGGCAGCTTCCAGTTACCCGCACCAAAATCGACTGGAACAAGATACTCAGTTACAAGATTGGCAAAGAAATGCAGAATGCTTAAAG

GCCGTCTCTAGGAGTCTCCAGTACATGGAAAGAAAAGGATTCAACACGGTGTGGTCATATGACGAATAAGTGATTTATAAACAAACAAGAGTGATATTTT

GCTAGTTAACAAAGTTAACAGATCTTCTAGCCTCATGGAATACTGTTGAACCTACAGCACTGTCTTGATTCTTTTGTGTGTGTTCTTTGCTTTGTAATTT

TCTGTTATCACTATATCTACTTGTAAATCTTTTTTTTTAATTCTGCTACATTTAATGTCGAAGAGCTATATCCTGAAGTCATTTTACTGTTTAGAACATT

TCCTAGCCATGCAGTCCTAGGACTGGTTTTTACAGAGTATCTGTTGAGTACTTTTTACCCCTGTGCTTTAAAGCACTTCCAGTGCTTCAGTGGCTTTTAG

TGATCCACCAATTGCTGAAGAGGCTATGCTACCAAGAGCTAAGTGGACAACACACTCCTTCTCTGTCCGACTGCTTTGGTCATTTACAGCATCTCACAAT

TGTAGATTTCAGACATTTGGATTGGGGCTTTTGGGGTCCATGTTGGGAGGCAAAGTTTCCTGGAAATTCCATGGCAGCAGCTTCTCTAGGGTCTTGATTT

TAAATCCAAAGACTTGAACCACATCCCCTGCTGCACATGAATGTTTGCTTACTTTCATTTTCTCATTGTCTCCTCCCATCTGGTTCTGTTGTAACCATGG

ATGTCTGTAGGAAGAACAGCCTAGAGAAAGCACTGGGAAACCAGGGTTGTCAGTCCCATGGGTCTGTTTCCCTCAGTGGAAGGAAGTGAAGGATGCCTGA

TGACTAGTATGCTGGAGTGCTGTGCTCAGACAGCCTGATGAGCCTCTGCTCACTGTGAAGGACCAGCCTCCACCTCAATCTCTCTCACCCACCCCATGTT

CTGAGCAATGTTTAGACCCTAATACTGGCCTTTGTCTCTCAGTGAGTAGAACTTATGCCGATTCATATCCTTCCTCTCTGGGCCCTCGTCCTAAGTTCTG

TTTTTCAGTCAATAGAGTTCATGTTTATTGTAAAGGTCACAGGTGCTTTACTACCTTGCAAGGGACTTTAGATGTAGCCGGCCCTGAAGCTTTGTTATAA

GAGTTGTCACACAGAGACTTTTCCCCAGAGTTCTACTATGTTTAAATGTGTGGAAAAATTAAAACATAGGATCAGAGTCCAGAAGTCTTGATCCAGTCTG

ACCAAGTCTGGCTATACCAAGTTTTCATTCTTATCCATCCTGGGTCCACTTTTCCTGCCAGTGGCAATACCTGCAGAAACGCCTCAACAGATGTTGGCAT

TTTTAGAAGAGTTTTGCCCATTAGTATTGCTCTTTCATAGTTGAGAACTGCTGACATACTATCAATGTAGTAGAATATAAAACTTGAAAACACAGACATT

GAAGGAATCATAGGTATTTTTGCTTTATGCTCTCTGGCAGGATTGTTCTGTAAGCAGACGAATAAATAGCTGTGTCCCTCACAAAGCTGGAATGAACCAA

AGTGAAAAGGACGGTTCCCAGGCAGCATCTGTCAGTATGTCAGAGTGCTAGTGCTTCCTTCTAAACAGGATGACCAAGTCATTCCAGTTCATCTTTTCCA

TCATCCTACCTGCCTAGAACTCATGTGTAACTGTGATATAGCTACCTTCCCAGGTATATTGGCAGGTGTGTGTGTGTGTGTGTGATCTCAGAACACACAG

GTAATGTGATGTGACCTATGACAACTGGTAATGGTGGATTCATTTACATTGTTTACACTTCTATGACCAGGCCTTAGGGGAAGGTCAGTTTTTTAAAAAC

CAAGTAGTGTCTTCCTACCTGTCCCCAAGTACAAGGTAAAACAGAAGGCTGTTGGCTTCAGCTTTCTTTTCTTTTTTGCTCAGTAATACTGTCAAGCAGG

AGTTTGTTTGCAAATGAAAGCTGTGTAAGCATTTTTGTTTATTTCAAATAAAATATATTTGTATTATTTGTCATTCATACTATCCATCCATGCCACACTG

TCTTCTGTACCAGGTAGCCCAATAGAAATACACCTGTTTTGTTCT
Translation
MADFEDRVSDEEK - UNI7213 - VRIAAKFITHAPPGEFNEVFND DVRLLLNNDNLLREGAAH HAFAQYNMDQFTPVKIEGYDDQ VLITEHGDL

GNSRFLDPRNQISFKFDHLRKEASDPQPEDVDGGLKSWRESCDSALRAYVKDHYSNGFCT VYAKTIDGQQTIIACIESHQFQPKNFW WNGRWRSEWKF

TITPPSAQVVGVLKIQ VHYYEDGNVQLVSHKDVQDSVTVS NEIQTTKEFIKIIESAENEYQ TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILS

YKIGKEMQNA

For any suggestions or comments, please send an email to unitrap@crg.es