Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070390 (Nlrp1b)
Chromosomal location
Chr 11: 70966604 - 71044229 (-)
Description
NLR family, pyrin domain containing 1B Gene [Source:MGI (curated);Acc:Nlrp1b-001]
RefSeq_dna
NM_001040696 
RefSeq_peptide
NP_001035786.1 
MGI
MGI:3582959 
Uniprot/SPTREMBL
Q2LKV8 A1Z198 Q2LK61 
Human Ortholog
not available
Omim not available
UniTrap UNI34799
Vector Insertion
Chr 11: 71014649 - 71032025
Public Clones IST12087F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37995
Vector Insertion
Chr 11: 70986460 - 70996367
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108516
Sequence
CAAGGACACACACTCCAGTGGAAGAGTGGG GTCTCCTCTATCAGTTCTGATCAAACACCCATTCACAGAGCAGAACTACCTGGCAGAGATGAGAAGCCA

CTGGTCTCCTGCTTGCAACAACAGAAGATAGTCTTGAAGCAATAAGAACACAGTCTGTTCAGAGAAGCAGTATCCGAGAGCTCCGTCACCATGGAACAAT

CTCAGCCCAAGAAGAAAAGTCGCACAAAGGTGGCTCAGCATGAGGGTCAACTAAATTTGAACCCCACCTTCAAAACAAGGAAACGTAAAGAGGTGGAGCT

GATGAAGCGCAGACCCAAGCCAGAGGGACACTTGAAGCTAG - UNI34799 - GGACAATTCCAAAAGTACACATAAAACAAAAAGGAGAGACTCTGG

ACCCCACATGGTCAAGGAAAAGAAAGAATCTGGTCCAAAAGTTAACAAACCTACTACTCTTTGAAAAATTGTGCTCAAGAGGCTCAGAAAACTTGATCAG

GAAAAGCTGGTATTCATGTGAAGAAGAAGAAAGAGGACATATGATTGAGATCCAAGACTTATTTGGCCCAAACAGAGGTACCCATAAAAAGCCTCAATTA

GTCATAATAGAGGGTGCTGCTGGAATTGGGAAGTCAACACTGGCCAGGCAGGTGAAGAGAGCCTGGAAGGAAGGCCAGCTCTACAGGAATCACTTCCAGC

ATGTCTTCTTCCTCAGTTGCAGGGAGCTGGCCCAGTATGAGCAGCTGAGTCTGGCTGAGCTCATAGCACAAGGCCAGGAAGTGCCCACCGTTCCCATCAG

GCAGATCCTGTCTCACCCTAAGGAGCTGCTCTTCATCCTGGATGGCATAGATGAGCCAGCATGGGTCTTGGCAGACCAGAATCCTGAGCTATGTCTGCAC

TGGAGTCAAAGACAGCCTGTGCACACTCTGCTGGGCAGTTTACTAGGGAAATCCATCCTTCCTGGGGCTTCCTTCTTGCTCACAGCTCGGACCACAGCTC

TACAGAAGATCATTCCTTATGTGGGGCAGCCACGTCGGGTGGAAGTCCTGGGGTTCTCCAAGTTTGAACGGGAGGTCTATTTCCGCAAATATTTTGTGAA

GGAGAGCGATGCAATTGCTGCTTTTAGATTGGTGGTATCTAACCCAGTGCTCCTGACCCTGTGTGAGGTTCCCTGGGTGTGCTGGTTGGTCTGCACTTGC

CTGAAAAAGCAGATGGAGCAGGGTGGAGAGCTCTCCCTGACCTCACAGACCACCACAGCCCTCTGCCTGAAATACCTTTCCCTGACAATCCCAGGGCAGC

ACATGAGGACCCAGCTCAGAGCCCTCTGCTCACTGGCTGCTGAGGGGATCTGCCAAAGAAGAACCCTGTTCAGTGAAAGCGACCTCTGTAAGCAAGGGTT

AGCAGAGGATGCCATTGCCACTTTCCTGAAGATCGGTATCCTTCAAAAGCAGGCCAGCTCTCTGAGCTACAGCTTTGCCCACTTGTGTCTCCAGGAGTTC

TTTGCAGTCATGTCTTACATCTTGGAGGATAGTGATGAAAGATGTGATGGTATGGAATTCAAAAGAACTGTGGAAACACTGATAGAAGTATATGGAAGAC

ATACTCTGTGTGAGGAACCCACTGTGCACTTTCTATTTGGTCTTGTGAATGAACAGGGAATGAGAGAAATGAAAAAGATCTTTGACTGCAAACTGCCTTT

GGGGACAGAGTTGAAGATGCTAAAGAGCACCCTAGGGAACCCAACCTATCAACATCATCTGGGTTTGCTCCACTGTCTGTATGAAAGTCAGGAAGAGGTG

CTCCTGACATATGTGTTATGTAATCTTCACTTAACAGGGCCTGACAAAAATTACATGGAAGCCACAGTGTCACAGACAAATGTGAAGCACCTGGTGATAC

AGACAGATATGGAGCTCATGGTGGTCACTTTCTGCATTCAGTTCTGTTGTCACGTGAGGAGTCTTCGGGTGAACATGAAAGGACAGCAGGGACATAAGCT

GACAGTTGCCAGTATGGTTCT - UNI34799 - GTACAGGTGGACCCCAATCACTAATGCCAGTTGGAAGATTCTTTTCTACAATCTTAAATTCAACA

GTAATCTGGAGGGGTTGGACCTCAGTGGAAATCCACTGAGTTACTCTGCAGTGCAATATCTCTGTGATGCCATGATATACCCTGGCTGCCAACTAAAGAC

TTTGTG GCTTGTTGAATGCGGCCTCACACCCACATACTGCTCACTCCTGGCCTCAGTGCTCAGTGCCTGCTCCAGCCTGAGAGAGCTAGACCTGCAGCT

AAATGACCTGTGTGACGATGGTGTAAGGATGCTGTGTGAGGGGCTCAGGAATCGTGCCTGCAACCTCAGAATCCTGCG GCTGGACCTGTACTCTCTCAG

TGCCCAGGTGATTACAGAGCTCAGGACACTGGAGGAAAATAATCTGAAGCTGCACATCTCCAGCATCTG GATGCCACAAATGATGGTCCCCACTGAGAA

CATGGATGAAGAAGATATCCTGACCTCATTCAAGCAGCAGAGACAACAGTCAG GAGCCAATCCCATGGAAATTCTGGGGACTGAAGAAGACTTCTGGGG

CCCTATAGGACCTGTGGCTACTGAGGTGGTTTACAGAGAAAGGAACCTGTACCG AGTTCAATTGCCCATGGCTGGTTCCTACCACTGTCCCAGCACAAG

ACTCCACTTTGTAGTGACAAGGGCAGTGACAATAGAGATCGAATTCTGTGCCTGGAGCCAATTCCTGGACAAGACTCCCTTGCAGCAGAGTCACATGGTG

GTTGGACCTCTGTTTGACATCAAGGCTGAGCAAGGAGCTGTGACTGCAGTGTACCTCCCTCATTTTGTGTCCCTCAAAG ACACAAAGGCAAGCACATTT

GACTTCAAGGTGGCCCACTTTCAAGAACATGGGATGGTTCTAGAAACGCCAGATAGGGTGAAGCCTGGATACACAGTACTGAAAAACCCAAGCTTCTCCC

CAATGGGAGTTGTACTGAGAATAATCCCTGCTGCCCGGCACTTCATCCCCATTACTTCCATCACACTGATCTACTATCGAGTCAATCAGGAAGAAGTCAC

CCTTCACCTCTACCTAGTCCCTAATGACTGCACCATACAGAAG GCCATAGATGATGAAGAAATGAAGTTTCAGTTTGTGAGAATAAACAAGCCACCCCC

AGTAGACAATCTTTTCATTGGCTCCCGCTACATTGTGTCTGGTTCTGAGAACCTGGAAATCACCCCAAAG GAACTGGAGCTGTGCTACAGGAGCAGCAA

GGAATTCCAACTCTTCTCTGAGATATACGTTGGAAACATGGGTTCAGAGATTAAGCTGCAAATCAAAAACAAAAAGCACATGAAACTCATATGGGAAGCC

TTGCTGAAACCAG GAGACCTCAGACCTGCTCTGCCCAGGATTGCCCAAGCCCTCAAAG ATGCCCCTTCCTTGCTGCACTTCATGGACCAGCATCGGGA

GCAGCTGGTAGCCCGAGTGACATCAGTGGACCCTCTCTTGGACAAGCTGCATGGTCTGGTGCTGAATGAAGAATCCTATGAGGCAGTGCGGGCTGAGAAC

ACAAACCAAGATAAGATGAGGAAGCTCTTCAACCTCAGCCGGTCCTGGAGTCGAGCCTGCAAAGACCTATTCTACCAAGCTCTGAAGGAGACCCATCCTC

ACCTGGTCATGGACCTCTTAGAAAAGTCAGGTGGGGTCTCTTTGGGATCCTGACATTG ATAGGAGCCTGGCATCTCTTTTCCTGAGAGGCTTCATCCAG

CGCTGGATGGAAACAGATACAGAGACCCACAGACAACATCGCATAGTGCTTAAGAGGCTTCCAGAAAATTGAGGGATGGAACTGAGCAAGCTGGAGGGAT

CAAGGACACCACAAAAAAACCTACAGAGTCAACTAACCTGGGACCATGGGGACTCACAGAGATGGAACTACCAGCCAAAGAGCATGCAGTGACTGGACCT

AGGTTCCGTACATATTTGTAGCAGATGTGCTGCTTAGTCTTCATATGGGTCCACTAACAATAGAAGAGGAGGTTGTCTTTGTCTCTGTTGACTAATTTTG

GACCCCTTTCCTTTAACTGAACTGCATGAATGGGTCTCAGTGAAAAGGATGGGCTTAGGCCTTCTGTAAGTGGATGTTAGAGGATGGGATGGT
Translation
 MEQSQPKKKSRTKVAQHEGQLNLNPTFKTRKRKEVELMKRRPKPEGHLKLG - UNI34799 - GTIPKVHIKQKGETLDPTWSRKRKNLVQKLTNLL

LFEKLCSRGSENLIRKSWYSCEEEERGHMIEIQDLFGPNRGTHKKPQLVIIEGAAGIGKSTLARQVKRAWKEGQLYRNHFQHVFFLSCRELAQYEQLSLA

ELIAQGQEVPTVPIRQILSHPKELLFILDGIDEPAWVLADQNPELCLHWSQRQPVHTLLGSLLGKSILPGASFLLTARTTALQKIIPYVGQPRRVEVLGF

SKFEREVYFRKYFVKESDAIAAFRLVVSNPVLLTLCEVPWVCWLVCTCLKKQMEQGGELSLTSQTTTALCLKYLSLTIPGQHMRTQLRALCSLAAEGICQ

RRTLFSESDLCKQGLAEDAIATFLKIGILQKQASSLSYSFAHLCLQEFFAVMSYILEDSDERCDGMEFKRTVETLIEVYGRHTLCEEPTVHFLFGLVNEQ

GMREMKKIFDCKLPLGTELKMLKSTLGNPTYQHHLGLLHCLYESQEEVLLTYVLCNLHLTGPDKNYMEATVSQTNVKHLVIQTDMELMVVTFCIQFCCHV

RSLRVNMKGQQGHKLTVASMVL - UNI34799 - LYRWTPITNASWKILFYNLKFNSNLEGLDLSGNPLSYSAVQYLCDAMIYPGCQLKTLW WLVEC

GLTPTYCSLLASVLSACSSLRELDLQLNDLCDDGVRMLCEGLRNRACNLRILR RLDLYSLSAQVITELRTLEENNLKLHISSIW WMPQMMVPTENMDE

EDILTSFKQQRQQSG GANPMEILGTEEDFWGPIGPVATEVVYRERNLYR RVQLPMAGSYHCPSTRLHFVVTRAVTIEIEFCAWSQFLDKTPLQQSHMV

VGPLFDIKAEQGAVTAVYLPHFVSLKD DTKASTFDFKVAHFQEHGMVLETPDRVKPGYTVLKNPSFSPMGVVLRIIPAARHFIPITSITLIYYRVNQEE

VTLHLYLVPNDCTIQK AIDDEEMKFQFVRINKPPPVDNLFIGSRYIVSGSENLEITPK ELELCYRSSKEFQLFSEIYVGNMGSEIKLQIKNKKHMKLI

WEALLKPG GDLRPALPRIAQALKD DAPSLLHFMDQHREQLVARVTSVDPLLDKLHGLVLNEESYEAVRAENTNQDKMRKLFNLSRSWSRACKDLFYQA

LKETHPHLVMDLLEKSGGVSLGS 
Transcript ENSMUST00000108515
Sequence
ATGGAAGAATCTCAGTACAAGCAGGAACATAACAAAAAGGTAGCTCAGGATGAAGGTCAAGAGGACAAGGACACCATCTTCGAAACAATAGAAGCTATAG

AGGCAAAGCTGATGGAGCTCAAAACCAACCCAGAGAGTACCTTCAATTATG - UNI34799 - GAATATTTCCAGAAGTATATATGAATCAGGGAGAA

GAGATACTTTACCCAGCATGGTCATTGAAAGAGGAGAATTTGTTTCAAACTTTCAAAAGTCTACGACTGTTTCAAAAATTGTGCCCAAGAGGCTCAGGGA

ACTTGGTCAAGAAAAGCTGGTATCCATGTGTACCAGAAGAAGGAGGACATATAATTAATATCCAAGACTTATTTGGCCCAAATATAGGTACTCAGAAAGA

GCCTCAATTAGTCATAATAGAAGGGGCTGCTGGGATTGGGAAGTCAACACTGGCCAGGCAGGTGAAGAGAGCCTGGATGGAAGGCGAGCTCTACAGGGAT

CACTTCCAACATGTCTTCTTCTTCAGCTGCAGAGAGCTGGCCCAGTGCAAGAAGCTGAGTCTGGCTGAGCTCATAACACAAGGCCAGGATGTGCCCACAG

CTCCCATAAATCAGATCCTGTCTCACCCTGAGAAGCTGCTCTTCATCCTGGATGGCATAGATGAGCCAGCATGGGTCTTGGCAGACCAGAATCCTGAGCT

ATGTCTGTACTGGAGTCAAACACAGCCTGTGCACACACTACTGGGAAGTTTACTAGGGAAATCCATCCTTCCTGAGGCTTCCTTCTTGCTCACAACTCGC

ACCACAGCTCTACAGAAGTTCATTCCTTCTTTGCCACAGTCATGTCAGGTGGAAGTCCTAGGATTCAGTGATTTTGAACAGGAGATCTATATCTACAAAT

ATTTTGCAAAGCAAATATTTGGAATTAAAGCTCTTATGATGGTTGAGTCTAACCCAGTTCTCCTGACCCTGTGTGAGGTTCCCTGGGTGTGCTGGTTGGT

CTGCAATTGCCTGAAAAAGCAGATGGAGCAGGGTGGAGATGTCTCCCTGACCTCACAGACAACCACAGCCATCTGCCTAAAATACATTTCCCTAACAATC

CCAGTGCATCATATGAGGACCCAGCTCAGAGCCCTCTGCTCATTGGCTGCTGAAGGCATCTGGAAAAGAAGGACCCTGTTCAGTGAAAGCGACCTCTGTA

AGCAAGGGTTAGACGAGGATGCCGTTGCCATTTTCCTGAAGACTGGTGTCCTTCAAAAGCAGGCCAGCTCTCTGAGCTATAGCTTTGCCCACTTGTGTCT

CCAGGAGTTCTTTGCATCAATGTCTTGCATCTTGGAGGATAGTGAGGAACGACATGGTGATATGGAAATGGACAGAATTGTGGAAACACTGGTAGAACGG

TATGGAAGACAAAACCTGTTTGAGGCACCCACTGTGCGCTTTCTCTTTGGTCTTTTGAGTAAAGAGGGATTGAAAGAAATGGAAAAGCTCTTTTCCTGCA

GCCTTCCTGGGAAGACAAAGTTGAAACTACTATGGCACATCCTTGGGAAATCCCAACCCCATCAACCACCTTGCCTGGGTTTGCTCCACTGTCTATATGA

AAATCAGGATATGAAGCTCCTGACACATGTGATGCATGATCTTCAAGGAACAATAGTGCCTGACACAGATGACATTACACACACAGTGTTGCAGACAAAT

GTGAAGCACCTGGTGGTACGGACAGACATGGAGCTCATGGTGGTCACTTTCTGCATTCAGTTCTGCTCTCACATGAGGAGTCTACAGCTGAATATGGAAG

GACAACAAGGATATGCACTGACAGCCCCAAGGATGGTTCT GTACAGGTGGACCCCAATCACTAATGCCAGTTGGAAGATTCTTTTCTACAATCTTAAAT

TCAACAGTAATCTGGAGGGGTTGGACCTCAGTGGAAATCCACTGAGTTACTCTGCAGTGCAATATCTCTGTGATGCCATGATATACCCTGGCTGCCAACT

AAAGACTTTGTG GCTTGTTGAATGCGGCCTCACACCCACATACTGCTCACTCCTGGCCTCAGTGCTCAGTGCCTGCTCCAGCCTGAGAGAGCTAGACCT

GCAGCTAAATGACCTGTGTGACGATGGTGTAAGGATGCTGTGTGAGGGGCTCAGGAATCGTGCCTGCAACCTCAGAATCCTGCG GCTGGACCTGTACTC

TCTCAGTGCCCAGGTGATTACAGAGCTCAGGACACTGGAGGAAAATAATCTGAAGCTGCACATCTCCAGCATCTG GATGCCACAAATGATGGTCCCCAC

TGAGAACATGGATGAAGAAGATATCCTGACCTCATTCAAGCAGCAGAGACAACAGTCAG GAGCCAATCCCATGGAAATTCTGGGGACTGAAGAAGACTT

CTGGGGCCCTATAGGACCTGTGGCTACTGAGGTGGTTTACAGAGAAAGGAACCTGTACCG AGTTCAATTGCCCATGGCTGGTTCCTACCACTGTCCCAG

CACAAGACTCCACTTTGTAGTGACAAGGGCAGTGACAATAGAGATCGAATTCTGTGCCTGGAGCCAATTCCTGGACAAGACTCCCTTGCAGCAGAGTCAC

ATGGTGGTTGGACCTCTGTTTGACATCAAGGCTGAGCAAGGAGCTGTGACTGCAGTGTACCTCCCTCATTTTGTGTCCCTCAAAG ACACAAAGGCAAGC

ACATTTGACTTCAAGGTGGCCCACTTTCAAGAACATGGGATGGTTCTAGAAACGCCAGATAGGGTGAAGCCTGGATACACAGTACTGAAAAACCCAAGCT

TCTCCCCAATGGGAGTTGTACTGAGAATAATCCCTGCTGCCCGGCACTTCATCCCCATTACTTCCATCACACTGATCTACTATCGAGTCAATCAGGAAGA

AGTCACCCTTCACCTCTACCTAGTCCCTAATGACTGCACCATACAGAAG GCCATAGATGATGAAGAAATGAAGTTTCAGTTTGTGAGAATAAACAAGCC

ACCCCCAGTAGACAATCTTTTCATTGGCTCCCGCTACATTGTGTCTGGTTCTGAGAACCTGGAAATCACCCCAAAG GAACTGGAGCTGTGCTACAGGAG

CAGCAAGGAATTCCAACTCTTCTCTGAGATATACGTTGGAAACATGGGTTCAGAGATTAAGCTGCAAATCAAAAACAAAAAGCACATGAAACTCATATGG

GAAGCCTTGCTGAAACCAG GAGACCTCAGACCTGCTCTGCCCAGGATTGCCCAAGCCCTCAAAG ATGCCCCTTCCTTGCTGCACTTCATGGACCAGCA

TCGGGAGCAGCTGGTAGCCCGAGTGACATCAGTGGACCCTCTCTTGGACAAGCTGCATGGTCTGGTGCTGAATGAAGAATCCTATGAGGCAGTGCGGGCT

GAGAACACAAACCAAGATAAGATGAGGAAGCTCTTCAACCTCAGCCGGTCCTGGAGTCGAGCCTGCAAAGACCTATTCTACCAAGCTCTGAAGGAGACCC

ATCCTCACCTGGTCATGGACCTCTTAGAAAAGTCAGGTGGGGTCTCTTTGGGATCCTGACATTG ATAGGAGCCTGGCATCTCTTTTCCTGAGAGGCTTC

ATCCAGCGCTGGATGGAAACAGATACAGAGACCCACAGACAACATCGCATAGTGCTTAAGAGGCTTCCAGAAAATTGAGGGATGGAACTGAGCAAGCTGG

AGGGATCAAGGACACCACAAAAAAACCTACAGAGTCAACTAACCTGGGACCATGGGGACTCACAGAGATGGAACTACCAGCCAAAGAGCATGCAGTGACT

GGACCTAGGTTCCGTACATATTTGTAGCAGATGTGCTGCTTAGTCTTCATATGGGTCCACTAACAATAGAAGAGGAGGTTGTCTTTGTCTCTGTTGACTA

ATTTTGGACCCCTTTCCTTTAACTGAACTGCATGAATGGGTCTCAGTGAAAAGGATGGGCTTAGGCCTTCTGTAAGTGGATGTTAGAGGATGGGATGGT
Translation
MEESQYKQEHNKKVAQDEGQEDKDTIFETIEAIEAKLMELKTNPESTFNYG - UNI34799 - GIFPEVYMNQGEEILYPAWSLKEENLFQTFKSLRL

FQKLCPRGSGNLVKKSWYPCVPEEGGHIINIQDLFGPNIGTQKEPQLVIIEGAAGIGKSTLARQVKRAWMEGELYRDHFQHVFFFSCRELAQCKKLSLAE

LITQGQDVPTAPINQILSHPEKLLFILDGIDEPAWVLADQNPELCLYWSQTQPVHTLLGSLLGKSILPEASFLLTTRTTALQKFIPSLPQSCQVEVLGFS

DFEQEIYIYKYFAKQIFGIKALMMVESNPVLLTLCEVPWVCWLVCNCLKKQMEQGGDVSLTSQTTTAICLKYISLTIPVHHMRTQLRALCSLAAEGIWKR

RTLFSESDLCKQGLDEDAVAIFLKTGVLQKQASSLSYSFAHLCLQEFFASMSCILEDSEERHGDMEMDRIVETLVERYGRQNLFEAPTVRFLFGLLSKEG

LKEMEKLFSCSLPGKTKLKLLWHILGKSQPHQPPCLGLLHCLYENQDMKLLTHVMHDLQGTIVPDTDDITHTVLQTNVKHLVVRTDMELMVVTFCIQFCS

HMRSLQLNMEGQQGYALTAPRMVL LYRWTPITNASWKILFYNLKFNSNLEGLDLSGNPLSYSAVQYLCDAMIYPGCQLKTLW WLVECGLTPTYCSLLA

SVLSACSSLRELDLQLNDLCDDGVRMLCEGLRNRACNLRILR RLDLYSLSAQVITELRTLEENNLKLHISSIW WMPQMMVPTENMDEEDILTSFKQQR

QQSG GANPMEILGTEEDFWGPIGPVATEVVYRERNLYR RVQLPMAGSYHCPSTRLHFVVTRAVTIEIEFCAWSQFLDKTPLQQSHMVVGPLFDIKAEQ

GAVTAVYLPHFVSLKD DTKASTFDFKVAHFQEHGMVLETPDRVKPGYTVLKNPSFSPMGVVLRIIPAARHFIPITSITLIYYRVNQEEVTLHLYLVPND

CTIQK AIDDEEMKFQFVRINKPPPVDNLFIGSRYIVSGSENLEITPK ELELCYRSSKEFQLFSEIYVGNMGSEIKLQIKNKKHMKLIWEALLKPG GD

LRPALPRIAQALKD DAPSLLHFMDQHREQLVARVTSVDPLLDKLHGLVLNEESYEAVRAENTNQDKMRKLFNLSRSWSRACKDLFYQALKETHPHLVMD

LLEKSGGVSLGS 
Transcript ENSMUST00000108514
Sequence
TTAGGAATATTTCCAGAAGTATATATGAATCAGGGAGAAGAGATACTTTACCCAGCATGGTCATTGAAAGAGGAGAATTTGTTTCAAACTTTCAAAAGTC

TACGACTGTTTCAAAAATTGTGCCCAAGAGGCTCAGGGAACTTGGTCAAGAAAAGCTGGTATCCATGTGTACCAGAAGAAGGAGGACATATAATTAATAT

CCAAGACTTATTTGGCCCAAATATAGGTACTCAGAAAGAGCCTCAATTAGTCATAATAGAAGGGGCTGCTGGGATTGGGAAGTCAACACTGGCCAGGCAG

GTGAAGAGAGCCTGGATGGAAGGCGAGCTCTACAGGGATCACTTCCAACATGTCTTCTTCTTCAGCTGCAGAGAGCTGGCCCAGTGCAAGAAGCTGAGTC

TGGCTGAGCTCATAACACAAGGCCAGGATGTGCCCACAGCTCCCATAAATCAGATCCTGTCTCACCCTGAGAAGCTGCTCTTCATCCTGGATGGCATAGA

TGAGCCAGCATGGGTCTTGGCAGACCAGAATCCTGAGCTATGTCTGTACTGGAGTCAAACACAGCCTGTGCACACACTACTGGGAAGTTTACTAGGGAAA

TCCATCCTTCCTGAGGCTTCCTTCTTGCTCACAACTCGCACCACAGCTCTACAGAAGTTCATTCCTTCTTTGCCACAGTCATGTCAGGTGGAAGTCCTAG

GATTCAGTGATTTTGAACAGGAGATCTATATCTACAAATATTTTGCAAAGCAAATATTTGGAATTAAAGCTCTTATGATGGTTGAGTCTAACCCAGTTCT

CCTGACCCTGTGTGAGGTTCCCTGGGTGTGCTGGTTGGTCTGCAATTGCCTGAAAAAGCAGATGGAGCAGGGTGGAGATGTCTCCCTGACCTCACAGACA

ACCACAGCCATCTGCCTAAAATACATTTCCCTAACAATCCCAGTGCATCATATGAGGACCCAGCTCAGAGCCCTCTGCTCATTGGCTGCTGAAGGCATCT

GGAAAAGAAGGACCCTGTTCAGTGAAAGCGACCTCTGTAAGCAAGGGTTAGACGAGGATGCCGTTGCCATTTTCCTGAAGACTGGTGTCCTTCAAAAGCA

GGCCAGCTCTCTGAGCTATAGCTTTGCCCACTTGTGTCTCCAGGAGTTCTTTGCATCAATGTCTTGCATCTTGGAGGATAGTGAGGAACGACATGGTGAT

ATGGAAATGGACAGAATTGTGGAAACACTGGTAGAACGGTATGGAAGACAAAACCTGTTTGAGGCACCCACTGTGCGCTTTCTCTTTGGTCTTTTGAGTA

AAGAGGGATTGAAAGAAATGGAAAAGCTCTTTTCCTGCAGCCTTCCTGGGAAGACAAAGTTGAAACTACTATGGCACATCCTTGGGAAATCCCAACCCCA

TCAACCACCTTGCCTGGGTTTGCTCCACTGTCTATATGAAAATCAGGATATGAAGCTCCTGACACATGTGATGCATGATCTTCAAGGAACAATAGTGCCT

GACACAGATGACATTACACACACAGTGTTGCAGACAAATGTGAAGCACCTGGTGGTACGGACAGACATGGAGCTCATGGTGGTCACTTTCTGCATTCAGT

TCTGCTCTCACATGAGGAGTCTACAGCTGAATATGGAAGGACAACAAGGATATGCACTGACAGCCCCAAGGATGGTTCT GTACAGGTGGACCCCAATCA

CTAATGCCAGTTGGAAGATTCTTTTCTACAATCTTAAATTCAACAGTAATCTGGAGGGGTTGGACCTCAGTGGAAATCCACTGAGTTACTCTGCAGTGCA

ATATCTCTGTGATGCCATGATATACCCTGGCTGCCAACTAAAGACTTTGTG GCTTGTTGAATGCGGCCTCACACCCACATACTGCTCACTCCTGGCCTC

AGTGCTCAGTGCCTGCTCCAGCCTGAGAGAGCTAGACCTGCAGCTAAATGACCTGTGTGACGATGGTGTAAGGATGCTGTGTGAGGGGCTCAGGAATCGT

GCCTGCAACCTCAGAATCCTGCG GCTGGACCTGTACTCTCTCAGTGCCCAGGTGATTACAGAGCTCAGGACACTGGAGGAAAATAATCTGAAGCTGCAC

ATCTCCAGCATCTG GATGCCACAAATGATGGTCCCCACTGAGAACATGGATGAAGAAGATATCCTGACCTCATTCAAGCAGCAGAGACAACAGTCAG G

AGCCAATCCCATGGAAATTCTGGGGACTGAAGAAGACTTCTGGGGCCCTATAGGACCTGTGGCTACTGAGGTGGTTTACAGAGAAAGGAACCTGTACCG 

AGTTCAATTGCCCATGGCTGGTTCCTACCACTGTCCCAGCACAAGACTCCACTTTGTAGTGACAAGGGCAGTGACAATAGAGATCGAATTCTGTGCCTGG

AGCCAATTCCTGGACAAGACTCCCTTGCAGCAGAGTCACATGGTGGTTGGACCTCTGTTTGACATCAAGGCTGAGCAAGGAGCTGTGACTGCAGTGTACC

TCCCTCATTTTGTGTCCCTCAAAG ACACAAAGGCAAGCACATTTGACTTCAAGGTGGCCCACTTTCAAGAACATGGGATGGTTCTAGAAACGCCAGATA

GGGTGAAGCCTGGATACACAGTACTGAAAAACCCAAGCTTCTCCCCAATGGGAGTTGTACTGAGAATAATCCCTGCTGCCCGGCACTTCATCCCCATTAC

TTCCATCACACTGATCTACTATCGAGTCAATCAGGAAGAAGTCACCCTTCACCTCTACCTAGTCCCTAATGACTGCACCATACAGAAG GCCATAGATGA

TGAAGAAATGAAGTTTCAGTTTGTGAGAATAAACAAGCCACCCCCAGTAGACAATCTTTTCATTGGCTCCCGCTACATTGTGTCTGGTTCTGAGAACCTG

GAAATCACCCCAAAG GAACTGGAGCTGTGCTACAGGAGCAGCAAGGAATTCCAACTCTTCTCTGAGATATACGTTGGAAACATGGGTTCAGAGATTAAG

CTGCAAATCAAAAACAAAAAGCACATGAAACTCATATGGGAAGCCTTGCTGAAACCAG AGTTTAAATTTGATCATCTCTGTGACCAAGAATTTTGTACT

ATCCTGAAGAACATAATGATCTCACCAGCAG GAGACCTCAGACCTGCTCTGCCCAGGATTGCCCAAGCCCTCAAAG ATGCCCCTTCCTTGCTGCACTT

CATGGACCAGCATCGGGAGCAGCTGGTAGCCCGAGTGACATCAGTGGACCCTCTCTTGGACAAGCTGCATGGTCTGGTGCTGAATGAAGAATCCTATGAG

GCAGTGCGGGCTGAGAACACAAACCAAGATAAGATGAGGAAGCTCTTCAACCTCAGCCGGTCCTGGAGTCGAGCCTGCAAAGACCTATTCTACCAAGCTC

TGAAGGAGACCCATCCTCACCTGGTCATGGACCTCTTAGAAAAGTCAGGTGGGGTCTCTTTGGGATCCTGACATTG ATAGGAGCCTGGCATCTCTTTTC

CTGAGAGGCTTCATCCAGCGCTGGATGGAAACAGATACAGAGACCCACAGACAACATCGCATAGTGCTTAAGAGGCTTCCAGAAAATTGAGGGATGGAAC

TGAGCAAGCTGGAGGGATCAAGGACACCACAAAAAAACCTACAGAGTCAACTAACCTGGGACCATGGGGACTCACAGAGATGGAACTACCAGCCAAAGAG

CATGCAGTGACTGGACCTAGGTTCCGTACATATTTGTAGCAGATGTGCTGCTTAGTCTTCATATGGGTCCACTAACAATAGAAGAGGAGGTTGTCTTTGT

CTCTGTTGACTAATTTTGGACCCCTTTCCTTTAACTGAACTGCATGAATGGGTCTCAGTGAAAAGGATGGGCTTAGGCCTTCTGTAAGTGGATGTTAGAG

GATGGGATGGT
Translation
LGIFPEVYMNQGEEILYPAWSLKEENLFQTFKSLRLFQKLCPRGSGNLVKKSWYPCVPEEGGHIINIQDLFGPNIGTQKEPQLVIIEGAAGIGKSTLARQ

VKRAWMEGELYRDHFQHVFFFSCRELAQCKKLSLAELITQGQDVPTAPINQILSHPEKLLFILDGIDEPAWVLADQNPELCLYWSQTQPVHTLLGSLLGK

SILPEASFLLTTRTTALQKFIPSLPQSCQVEVLGFSDFEQEIYIYKYFAKQIFGIKALMMVESNPVLLTLCEVPWVCWLVCNCLKKQMEQGGDVSLTSQT

TTAICLKYISLTIPVHHMRTQLRALCSLAAEGIWKRRTLFSESDLCKQGLDEDAVAIFLKTGVLQKQASSLSYSFAHLCLQEFFASMSCILEDSEERHGD

MEMDRIVETLVERYGRQNLFEAPTVRFLFGLLSKEGLKEMEKLFSCSLPGKTKLKLLWHILGKSQPHQPPCLGLLHCLYENQDMKLLTHVMHDLQGTIVP

DTDDITHTVLQTNVKHLVVRTDMELMVVTFCIQFCSHMRSLQLNMEGQQGYALTAPRMVL LYRWTPITNASWKILFYNLKFNSNLEGLDLSGNPLSYSA

VQYLCDAMIYPGCQLKTLW WLVECGLTPTYCSLLASVLSACSSLRELDLQLNDLCDDGVRMLCEGLRNRACNLRILR RLDLYSLSAQVITELRTLEEN

NLKLHISSIW WMPQMMVPTENMDEEDILTSFKQQRQQSG GANPMEILGTEEDFWGPIGPVATEVVYRERNLYR RVQLPMAGSYHCPSTRLHFVVTRA

VTIEIEFCAWSQFLDKTPLQQSHMVVGPLFDIKAEQGAVTAVYLPHFVSLKD DTKASTFDFKVAHFQEHGMVLETPDRVKPGYTVLKNPSFSPMGVVLR

IIPAARHFIPITSITLIYYRVNQEEVTLHLYLVPNDCTIQK AIDDEEMKFQFVRINKPPPVDNLFIGSRYIVSGSENLEITPK ELELCYRSSKEFQLF

SEIYVGNMGSEIKLQIKNKKHMKLIWEALLKPE EFKFDHLCDQEFCTILKNIMISPAG GDLRPALPRIAQALKD DAPSLLHFMDQHREQLVARVTSV

DPLLDKLHGLVLNEESYEAVRAENTNQDKMRKLFNLSRSWSRACKDLFYQALKETHPHLVMDLLEKSGGVSLGS 
Transcript ENSMUST00000094046
Sequence
CAAGGACACACACTCCAGTGGAAGAGTGGG GTCTCCTCTATCAGTTCTGATCAAACACCCATTCACAGAGCAGAACTACCTGGCAGAGATGAGAAGCCA

CTGGTCTCCTGCTTGCAACAACAGAAGATAGTCTTGAAGCAATAAGAACACAGTCTGTTCAGAGAAGCAGTATCCGAGAGCTCCGTCACCATGGAACAAT

CTCAGCCCAAGAAGAAAAGTCGCACAAAGGTGGCTCAGCATGAGGGTCAACTAAATTTGAACCCCACCTTCAAAACAAGGAAACGTAAAGAGGTGGAGCT

GATGAAGCGCAGACCCAAGCCAGAGGGACACTTGAAGCTAG - UNI34799 - GGACAATTCCAAAAGTACACATAAAACAAAAAGGAGAGACTCTGG

ACCCCACATGGTCAAGGAAAAGAAAGAATCTGGTCCAAAAGTTAACAAACCTACTACTCTTTGAAAAATTGTGCTCAAGAGGCTCAGAAAACTTGATCAG

GAAAAGCTGGTATTCATGTGAAGAAGAAGAAAGAGGACATATGATTGAGATCCAAGACTTATTTGGCCCAAACAGAGGTACCCATAAAAAGCCTCAATTA

GTCATAATAGAGGGTGCTGCTGGAATTGGGAAGTCAACACTGGCCAGGCAGGTGAAGAGAGCCTGGAAGGAAGGCCAGCTCTACAGGAATCACTTCCAGC

ATGTCTTCTTCCTCAGTTGCAGGGAGCTGGCCCAGTATGAGCAGCTGAGTCTGGCTGAGCTCATAGCACAAGGCCAGGAAGTGCCCACCGTTCCCATCAG

GCAGATCCTGTCTCACCCTAAGGAGCTGCTCTTCATCCTGGATGGCATAGATGAGCCAGCATGGGTCTTGGCAGACCAGAATCCTGAGCTATGTCTGCAC

TGGAGTCAAAGACAGCCTGTGCACACTCTGCTGGGCAGTTTACTAGGGAAATCCATCCTTCCTGGGGCTTCCTTCTTGCTCACAGCTCGGACCACAGCTC

TACAGAAGATCATTCCTTATGTGGGGCAGCCACGTCGGGTGGAAGTCCTGGGGTTCTCCAAGTTTGAACGGGAGGTCTATTTCCGCAAATATTTTGTGAA

GGAGAGCGATGCAATTGCTGCTTTTAGATTGGTGGTATCTAACCCAGTGCTCCTGACCCTGTGTGAGGTTCCCTGGGTGTGCTGGTTGGTCTGCACTTGC

CTGAAAAAGCAGATGGAGCAGGGTGGAGAGCTCTCCCTGACCTCACAGACCACCACAGCCCTCTGCCTGAAATACCTTTCCCTGACAATCCCAGGGCAGC

ACATGAGGACCCAGCTCAGAGCCCTCTGCTCACTGGCTGCTGAGGGGATCTGCCAAAGAAGAACCCTGTTCAGTGAAAGCGACCTCTGTAAGCAAGGGTT

AGCAGAGGATGCCATTGCCACTTTCCTGAAGATCGGTATCCTTCAAAAGCAGGCCAGCTCTCTGAGCTACAGCTTTGCCCACTTGTGTCTCCAGGAGTTC

TTTGCAGTCATGTCTTACATCTTGGAGGATAGTGATGAAAGATGTGATGGTATGGAATTCAAAAGAACTGTGGAAACACTGATAGAAGTATATGGAAGAC

ATACTCTGTGTGAGGAACCCACTGTGCACTTTCTATTTGGTCTTGTGAATGAACAGGGAATGAGAGAAATGAAAAAGATCTTTGACTGCAAACTGCCTTT

GGGGACAGAGTTGAAGATGCTAAAGAGCACCCTAGGGAACCCAACCTATCAACATCATCTGGGTTTGCTCCACTGTCTGTATGAAAGTCAGGAAGAGGTG

CTCCTGACATATGTGTTATGTAATCTTCACTTAACAGGGCCTGACAAAAATTACATGGAAGCCACAGTGTCACAGACAAATGTGAAGCACCTGGTGATAC

AGACAGATATGGAGCTCATGGTGGTCACTTTCTGCATTCAGTTCTGTTGTCACGTGAGGAGTCTTCGGGTGAACATGAAAGGACAGCAGGGACATAAGCT

GACAGTTGCCAGTATGGTTCT - UNI34799 - GTACAGGTGGACCCCAATCACTAATGCCAGTTGGAAGATTCTTTTCTACAATCTTAAATTCAACA

GTAATCTGGAGGGGTTGGACCTCAGTGGAAATCCACTGAGTTACTCTGCAGTGCAATATCTCTGTGATGCCATGATATACCCTGGCTGCCAACTAAAGAC

TTTGTG CTCAGCTGTGGAGAGCTTGGAATTCTGTACCTAG
Translation
 MEQSQPKKKSRTKVAQHEGQLNLNPTFKTRKRKEVELMKRRPKPEGHLKLG - UNI34799 - GTIPKVHIKQKGETLDPTWSRKRKNLVQKLTNLL

LFEKLCSRGSENLIRKSWYSCEEEERGHMIEIQDLFGPNRGTHKKPQLVIIEGAAGIGKSTLARQVKRAWKEGQLYRNHFQHVFFLSCRELAQYEQLSLA

ELIAQGQEVPTVPIRQILSHPKELLFILDGIDEPAWVLADQNPELCLHWSQRQPVHTLLGSLLGKSILPGASFLLTARTTALQKIIPYVGQPRRVEVLGF

SKFEREVYFRKYFVKESDAIAAFRLVVSNPVLLTLCEVPWVCWLVCTCLKKQMEQGGELSLTSQTTTALCLKYLSLTIPGQHMRTQLRALCSLAAEGICQ

RRTLFSESDLCKQGLAEDAIATFLKIGILQKQASSLSYSFAHLCLQEFFAVMSYILEDSDERCDGMEFKRTVETLIEVYGRHTLCEEPTVHFLFGLVNEQ

GMREMKKIFDCKLPLGTELKMLKSTLGNPTYQHHLGLLHCLYESQEEVLLTYVLCNLHLTGPDKNYMEATVSQTNVKHLVIQTDMELMVVTFCIQFCCHV

RSLRVNMKGQQGHKLTVASMVL - UNI34799 - LYRWTPITNASWKILFYNLKFNSNLEGLDLSGNPLSYSAVQYLCDAMIYPGCQLKTLC CSAVE

SLEFCT

For any suggestions or comments, please send an email to unitrap@crg.es