Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070392 (Hist2h3c1)
Chromosomal location
Chr 3: 96049477 - 96052431 (+)
Description
histone cluster 2, H3c1 Gene [Source:MGI (curated);Acc:Hist2h3c1-001]
RefSeq_dna
NM_178216 
RefSeq_peptide
NP_062342.1 NP_038576.1 NP_473386.1 NP_783584.1 NP_835511.1 NP_835512.1 NP_835510.1 NP_835587.1 NP_835734.1 
UniGene
Mm.400011 Mm.422680 
MGI
MGI:2448355 
Uniprot/SWISSPROT
P84228 
Uniprot/SPTREMBL
A1L0U3 
Human Ortholog
not available
Omim not available
UniTrap UNI33930
Vector Insertion
Chr 3: 96049476 - 96051220
Public Clones IST10102B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090779
Sequence
GGCCGTTCGTCTGTTTGCGCTTTCGTGATGTCCGGTCGTGGCAAGCAAGGAGGCAAGGCCCGCGCCAAGGCCAAGTCGCGGTCTTCCCGGGCCGGGCTAC

AGTTCCCGGTGGGGCGTGTGCACCGGCTGCTGCGCAAGGGCAACTACGCGGAGCGTGTGGGTGCCGGCGCGCCGGTATACATGGCGGCGGTGCTGGAGTA

CCTAACGGCCGAGATCCTGGAGCTGGCGGGCAACGCGGCCCGCGACAACAAGAAGACGCGCATCATCCCGCGCCACCTGCAGCTGGCCATCCGCAACGAC

GAGGAGCTCAACAAGCTGCTGGGCAAAGTGACGATCGCGCAGGGCGGCGTCCTGCCCAACATCCAGGCCGTGCTGCTGCCCAAGAAGACGGAGAGCCACC

ATAAGGCGAAGGGCAAGTGAGGCCACTGCTCGCGTCGGCCCGCGTCTCTGTGATATAACCCCCGCGAGCTCCTAAAAAGGCTCTTTTCAGAGCCACCCAC

TGAATCAGATAAAGAGTTGTGTCACGGTAGCCGGTCTTGGTGGCCTTTCCTGGCCCTGCCCCAAAAGTAAGAGTGTCGTGTCCTCTGCTTCCTTGCCCAT

CCTGCCCGTGGTTCCCCCTGGTAGTTTGTTGTCGCTCTTTGGTTCATGCCCTGCCTCGGCGGAGCGGATACGCGGTTCTCGCTGACCGTCCCAAGCATTT

AGCCCCTATCTGCCCACACCCTTGTCCTACACAACACTGTCCCTCACTCAGCGTCCACCCGCCTGACCCTTCCCAGGACTAAGACTCAACTAGGACGTCT

AGGCCAATCTAGACATAAGTCGCAGTCAGCCGCGCTCTCGTCCGGTCCTTGGGGAATGTCTAGGAGGAGGAGGTGTCCCGCGAGGACTGGACGCGGCCGG

CTCTAGGGATCATGGGGGACTGGGGCTGGGACTGTGGCTGTGGCTGGGCGGTGCTGCACAAACACTAGATTAGTTCTGCCCTGGGACTTTGGGCGGCGGG

CGGGGGCGCGCGAGCTCCTCTTGGGCAGAGCCGGGACCCGCCCTCTACGGGCAGCTGCCAGACGTGGCTCCACCCTCGCAGAACGTTGGCAAGTGGACCG

GGCGCGGGGCTGGACGTGGGGGGCGGGGGGGGGCGGGTCAGGTGGCGTGGCGGGCCCGAGCCAATGGGCGAGGTCGGGGCCGGTGACGCCACGGCCAATG

GCGCGGCAGCGCGGGAGTTTCAAGTCGCTGTCTCCGCCCCGCCGCGGGGAAGACTGCGCCTATAAAGGCGGCCGGCTCGGGCCGGTATCAGGTCCCCGAG

TGCTCCTCGTTTGGGTGTCTTCCGTCTTCGCCATGGCCCGTACGAAGCAGACTGCCCGCAAGTCCACCGGCGGCAAGGCCCCGCGCAAGCAGCTGGCCAC

CAAGGCCGCCCGCAAGAGCGCCCCGGCCACGGGCGGCGTGAAGAAGCCGCACCGCTACCGGCCCGGCACCGTGGCGCTGCGGGAGATCCGGCGCTACCAG

AAGTCGACCGAGCTGCTGATCCGCAAGCTGCCGTTCCAGCGCCTGGTGCGCGAGATCGCGCAGGACTTCAAGACGGACCTGCGCTTCCAGAGCTCGGCCG

TCATGGCGCTGCAGGAGGCGAGCGAGGCCTACCTGGTGGGGCTGTTCGAGGACACCAACCTGTGCGCCATCCACGCCAAACGCGTCACCATCATGCCCAA

GGACATCCAGTTGGCCCGCCGCATCCGTGGGGAGCGCGCTTAAGCGCCCTGTCTCCCATCCATTCCCCACAAAGGCTCTTTTCAGAGCCACCACAGCTTC

CCGGAAAGAGCTATTCAGCTTTTTGTCTTAAATTGCCTTTGCATTCTTCTAGGTTTCTGCAGTGGCTGGTGCTTACTGTCCACCGAGCCTCTTTTAATAG

TTGCCTATAGTCGCTTAAGAATGTGCTAATTTCGGGGGCAATTGCGAGCGCAGTGACTAAAATATCTTATCCAGGTGCTCAACCTCTGCATTCCTCTTCT

AACATCAGTCTTAATTCGTTTTTCTTTTATCTTTTTCGTTCCCTTCTAATGTAATTTGACATGATAGAGCTTTTTCTTTTTTTAAAATGAGCACCTGGCT

CATTGAAGCCAAGTGTCAGGCCTTGCAAGGCTACTTATATTGCCCTTTACAAATTAGTATACTTTATTGCTAACATGCGTTGCTTTTCTATGTTTTTGGA

GTAGATGTTTACAGCCACCTTCCAATGTTTTGATAGTTTACTTGGGAGATCCTCGTGTTCATTACATTACAGGTTTTAAGTTTTAGCATTGAGTATCTTA

TCTGCCTGCTATCAGGTGAGTTACTCCATTCAAATTTAATTACTATGATGATGGTATGTAAGTCGTGTGTGTGTGTTAGAGGTACCACATAGTAAAAGGC

TGACCTACAAACAACGTTCCTTTGGTTCCATTCTAATTGTCCTAATTTCAGATTATCCACTTTACTGATAGATAACTTTCCTTTCCCCCCTCTCATCTAT

TAGAAGTTCCTTGTCCTTTGCTCAAAACTCACAAATCACCAAATACTTTACAAATGCTTTTGAGTTGTATAACACTATTCTTCTGTCCAGACTCTTTCTT

GCCTTAGTTAACACCCTCAACAACCCTGGTCTAAGATTACATGTTTAGCAAGGTTTCTCACTGTCACTAAGTAACAATCTAGAAGGAGAATCTTGAAAAT

CCATTTAAATTTTAAAAAATTTAGATTTATATGTATGAATGCATTTTGCACATATGTATATATGTATGTATCATATGGCTACCTGGTACCTGAGGAGGCC

AAAAGAGGCTGATGGATCCCCTGGAACTGGAGTTATAGATGCCATGTGGGTTCTGGGAATTGAAACCTGATCCTCACCAAAGATGCTATTTGCTGAGCCA

TCTCTTCAGCCATTTTAATTATTTTTTAATCCCAATAAAAATTTAACACACTGCT
Translation
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAY

LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Transcript ENSMUST00000091711
Sequence
ATGGCGCGGCAGCGCGGGAGTTTCAAGTCGCTGTCTCCGCCCCGCCGCGGGGAAGACTGCGCCTATAAAGGCGGCCGGCTCGGGCCGGTATCAGGTCCCC

GAGTGCTCCTCGTTTGGGTGTCTTCCGTCTTCGCCATGGCCCGTACGAAGCAGACTGCCCGCAAGTCCACCGGCGGCAAGGCCCCGCGCAAGCAGCTGGC

CACCAAGGCCGCCCGCAAGAGCGCCCCGGCCACGGGCGGCGTGAAGAAGCCGCACCGCTACCGGCCCGGCACCGTGGCGCTGCGGGAGATCCGGCGCTAC

CAGAAGTCGACCGAGCTGCTGATCCGCAAGCTGCCGTTCCAGCGCCTGGTGCGCGAGATCGCGCAGGACTTCAAGACGGACCTGCGCTTCCAGAGCTCGG

CCGTCATGGCGCTGCAGGAGGCGAGCGAGGCCTACCTGGTGGGGCTGTTCGAGGACACCAACCTGTGCGCCATCCACGCCAAACGCGTCACCATCATGCC

CAAGGACATCCAGTTGGCCCGCCGCATCCGTGGGGAGCGCGCTTAA
Translation
MARQRGSFKSLSPPRRGEDCAYKGGRLGPVSGPRVLLVWVSSVFAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY

QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

For any suggestions or comments, please send an email to unitrap@crg.es