Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070424 (Art5)
Chromosomal location
Chr 7: 109245393 - 109251359 (-)
Description
ADP-ribosyltransferase 5 Gene [Source:MGI (curated);Acc:Art5-001]
RefSeq_dna
NM_007491 
RefSeq_peptide
NP_031517.2 
UniGene
Mm.2816 Mm.452738 
MGI
MGI:107948 
Uniprot/SWISSPROT
P70352 
Uniprot/SPTREMBL
O54739 Q14AG6 Q3V0V9 
Human Ortholog
ENSG00000167311 (ART5)
Omim not available
UniTrap UNI33171
Vector Insertion
Chr 7: 109248344 - 109251360
Public Clones IST13504A7 (tigm) IST14387D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32631
Vector Insertion
Chr 7: 109247947 - 109248454
Public Clones IST14601G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084835
Sequence
AATGAACAAGGAGAGATCCTCGTGGGGCTTCGTGGCCTGGGGGTCTGAGGGCCATGGCCCGGCCCAGGGCCACCGGAGAAGAGACCAAGTCTCACAGGTC

TCTCCCCCAACTTTGACTTAGTTCAGATCTTACAGAAAGAACCTATCATCCAAACGAAGGAGAGTTTTGCCCCTCAATCACCCAAGGACTCTGCCAGTTC

AGCTCCCACGCCCCTGTCTGTTGTTGGGGAAGATAGGTGTCGGGTTACCAGTCCAGGGGCTATAGTTAGCCCCGGGGACTTTGTCCAGCTGTTTGTTCAG

GATCTGCGATCTGCGAGCGCCTGCCGGCACTTCAGCTCCAGTCAGCCGCAAAGAACCATAGCCCTGGGCCGGGCCGCTCTCTGTCTCAACTTCTTCCAG 

- UNI32631 - - UNI33171 - CTTCACCCCTCATCCCTCCTGAGTTCCAGTCCTTGACTAAGGACCCTCCTAGGCTGAAGGAAGGAAGGTCCTGG

AGCCCATCCAAGCCAGCACTCCCCTCCACTGGCTTCATCATCATCAGGGTCCTGCTGTCTCGGGACTCGTCCTAGGATGATTCTGGAGGATCTGCTGATG

GTCCTCAGCTGCCTCAGCTTGCACGCCCTCTGGAAG - UNI32631 - GTTCGAGCTGTTCCTATCCTGCCCCTGAGCCTGGTTCCAGATACCTTTGA

TGATGCCTATGTGGGCTGCTCTGAGGAGATGGAGGAGAAAGCAGGCCTGCTGCTAAAGGAAGAGATGGCACGCCATGCCCTGCTGCGGGAATCCTGGGAA

GCAGCACAAGAGGCCTGGGCACACCGGCGTCACAAGCTCACTCTACCTCCTGGCTTCAAAGCCCAGCACGGAGTAGCGATTATGGTGTACACCAACTCAT

CCAACACCTTGTACTGGGAGCTGAACCAGGCCGTACGGACAGGAGGTGGCTCCCGGGAGCTCTACATGAGGCACTTCCCCTTCAAGGCCCTGCATTTCTA

CTTGACCCGGGCTCTGCAGCTGCTGCGGGGCTCTGGAGGGTGCAGTAGGGGACCTGGGGAGGTGGTGTTCCGAGGTGTGGGCAGTCTTCACTTTGAACCC

AAGAGGCTGGGGGACTCTGTCCGATTAGGACAGTTTACCTCCAGCTCTGTGGATGAGAGAGTGGCTCGCAGGTTTGGGAATGCCACCTTCTTCAATCTAA

GGACTTGTTTTGGGGCTCCTATCCAGGCGTTGTCTGTCTTCCCTGAGGAGCGTGAGGTGCTGATACCCCCACACGAAGTCTTCTTGGTCACTGGGTTCTC

CCAGGATGGAGCCCAGAGCATAGTGACTCTCTGGAGTTATGATCAGACCTGCAGCCACTTTAACTGCGCCTATTTGG GCGGGGACA AAGAGACGTGGC

TGTGTGTCCTCAAGAG TCGGGCAGCCAGAGGCACC CCACAGAGGCTCTGGCTCTGCAATCAGGAAAGACACTGCTCTTGGACCCAAGGAAGCTGCAGC

TCTCCAGAGCTGGACCCTGAAAGCCTCTTAGGACTCTTGGGAACTAATGACCTTACTATGAAGAAGGGGCTTTGA
Translation
 - UNI32631 - - UNI33171 - MILEDLLMVLSCLSLHALWK - UNI32631 - VRAVPILPLSLVPDTFDDAYVGCSEEMEEKAGLLLKEEM

ARHALLRESWEAAQEAWAHRRHKLTLPPGFKAQHGVAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLTRALQLLRGSGGCSRGPGEVV

FRGVGSLHFEPKRLGDSVRLGQFTSSSVDERVARRFGNATFFNLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTGFSQDGAQSIVTLWSYDQTCSHFNC

AYLG GGDK KETWLCVLKS SRAARGT PQRLWLCNQERHCSWTQGSCSSPELDPESLLGLLGTNDLTMKKGL
Transcript ENSMUST00000106940
Sequence
AATGAACAAGGAGAGATCCTCGTGGGGCTTCGTGGCCTGGGGGTCTGAGGGCCATGGCCCGGCCCAGGGCCACCGGAGAAGAGACCAAGTCTCACAGGTC

TCTCCCCCAACTTTGACTTAGTTCAGATCTTACAGAAAGAACCTATCATCCAAACGAAGGAGAGTTTTGCCCCTCAATCACCCAAGGACTCTGCCAGTTC

AGCTCCCACGCCCCTGTCTGTTGTTGGGGAAGATAGGTGTCGGGTTACCAGTCCAGGGGCTATAGTTAGCCCCGGGGACTTTGTCCAGCTGTTTGTTCAG

GATCTGCGATCTGCGAGCGCCTGCCGGCACTTCAGCTCCAGTCAGCCGCAAAGAACCATAGCCCTGGGCCGGGCCGCTCTCTGTCTCAACTTCTTCCAG 

- UNI32631 - - UNI33171 - CTTCACCCCTCATCCCTCCTGAGTTCCAGTCCTTGACTAAGGACCCTCCTAGGCTGAAGGAAGGAAGGTCCTGG

AGCCCATCCAAGCCAGCACTCCCCTCCACTGGCTTCATCATCATCAGGGTCCTGCTGTCTCGGGACTCGTCCTAGGATGATTCTGGAGGATCTGCTGATG

GTCCTCAGCTGCCTCAGCTTGCACGCCCTCTGGAAG - UNI32631 - GTTCGAGCTGTTCCTATCCTGCCCCTGAGCCTGGTTCCAGATACCTTTGA

TGATGCCTATGTGGGCTGCTCTGAGGAGATGGAGGAGAAAGCAGGCCTGCTGCTAAAGGAAGAGATGGCACGCCATGCCCTGCTGCGGGAATCCTGGGAA

GCAGCACAAGAGGCCTGGGCACACCGGCGTCACAAGCTCACTCTACCTCCTGGCTTCAAAGCCCAGCACGGAGTAGCGATTATGGTGTACACCAACTCAT

CCAACACCTTGTACTGGGAGCTGAACCAGGCC GCGTTGTCTGTCTTCCCTGAGGAGCGTGAGGTGCTGATACCCCCACACGAAGTCTTCTTGGTCACTG

GGTTCTCCCAGGATGGAGCCCAGAGCATAGTGACTCTCTGGAGTTATGATCAGACCTGCAGCCACTTTAACTGCGCCTATTTGGGTG GGGAGAAGAGAC

GTGGCTGTGTGTCCTCAAGAG CAGTCGGGCAGCCAGAGGCACCCTCCACAGAGGCTCTGGCTCTGCAATCAGGAAAGACACTGCTCTTGGACCCAAGGA

AGCTGCAGCTCTCCAGAGCTGGACCCTGAAAGCCTCTTAGGACTCTTGGGAACTAATGACCTTACTATGAAGAAGGGGCTTTGAACGGCTGCAGGAAGCA

GGAGTGTGGTTCTGGTTCCAGTCCTAGGAGCCACCTGTCCAACCAGAGTTGGAGATCTGAGGCCATGGCAGGGTTGAGGGAACCCCACAGTGTGGTGGGA

ACTTCCTAGGACATGCAAGGTAAAGACTGGATGGCTACTCAATTAAACAGAGTTGTGGTGTGG
Translation
 - UNI32631 - - UNI33171 - MILEDLLMVLSCLSLHALWK - UNI32631 - VRAVPILPLSLVPDTFDDAYVGCSEEMEEKAGLLLKEEM

ARHALLRESWEAAQEAWAHRRHKLTLPPGFKAQHGVAIMVYTNSSNTLYWELNQA ALSVFPEEREVLIPPHEVFLVTGFSQDGAQSIVTLWSYDQTCSH

FNCAYLGG GEKRRGCVSSRA AVGQPEAPSTEALALQSGKTLLLDPRKLQLSRAGP
Transcript ENSMUST00000106938
Sequence
GGCAGTAATCCCTGATCTCAGGCCAGGACTAGGCAAAGTCACCCGAGTACTTGCTGATGAAGGAAGTAAAATCTACAAACACCCAGCTTCAG - UNI33

171 - CAAATTGTATGCAAATAAGACAGATTTGGCGACTTAACTAGCGTAATGAACAAGGAGAGATCCTCGTGGGGCTTCGTGGCCTGGGGGTCTGAGG

GCCATGGCCCGGCCCAGGGCCACCGGAGAAGAGACCAAGTCTCACAGGTCTCTCCCCCAACTTTGACTTAGTTCAGATCTTACAGAAAGAACCTATCATC

CAAACGAAGGAGAGTTTTGCCCCTCAATCACCCAAGGACTCTGCCAGTTCAGCTCCCACGCCCCTGTCTGTTGTTGGGGAAGATAGGTGTCGGGTTACCA

GTCCAGGGGCTATAGTTAGCCCCGGGGACTTTGTCCAGCTGTTTGTTCAGGATCTGCGATCTGCGAGCGCCTGCCGGCACTTCAGCTCCAGTCAGCCGCA

AAGAACCATAGCCCTGGGCCGGGCCGCTCTCTGTCTCAACTTCTTCCAG - UNI32631 - - UNI33171 - GCTTCACCCCTCATCCCTCCTGAG

TTCCAGTCCTTGACTAAGGACCCTCCTAGGCTGAAGGAAGGAAGGTCCTGGAGCCCATCCAAGCCAGCACTCCCCTCCACTGGCTTCATCATCATCAGGG

TCCTGCTGTCTCGGGACTCGTCCTAGGATGATTCTGGAGGATCTGCTGATGGTCCTCAGCTGCCTCAGCTTGCACGCCCTCTGGAAG - UNI32631 -

 GTTCGAGCTGTTCCTATCCTGCCCCTGAGCCTGGTTCCAGATACCTTTGATGATGCCTATGTGGGCTGCTCTGAGGAGATGGAGGAGAAAGCAGGCCTG

CTGCTAAAGGAAGAGATGGCACGCCATGCCCTGCTGCGGGAATCCTGGGAAGCAGCACAAGAGGCCTGGGCACACCGGCGTCACAAGCTCACTCTACCTC

CTGGCTTCAAAGCCCAGCACGGAGTAGCGATTATGGTGTACACCAACTCATCCAACACCTTGTACTGGGAGCTGAACCAGGCCGTACGGACAGGAGGTGG

CTCCCGGGAGCTCTACATGAGGCACTTCCCCTTCAAGGCCCTGCATTTCTACTTGACCCGGGCTCTGCAGCTGCTGCGGGGCTCTGGAGGGTGCAGTAGG

GGACCTGGGGAGGTGGTGTTCCGAGGTGTGGGCAGTCTTCACTTTGAACCCAAGAGGCTGGGGGACTCTGTCCGATTAGGACAGTTTACCTCCAGCTCTG

TGGATGAGAGAGTGGCTCGCAGGTTTGGGAATGCCACCTTCTTCAATCTAAGGACTTGTTTTGGGGCTCCTATCCAGGCGTTGTCTGTCTTCCCTGAGGA

GCGTGAGGTGCTGATACCCCCACACGAAGTCTTCTTGGTCACTGGGTTCTCCCAGGATGGAGCCCAGAGCATAGTGACTCTCTGGAGTTATGATCAGACC

TGCAGCCACTTTAACTGCGCCTATTTGGGTG GGGAGAAGAGACGTGGCTGTGTGTCCTCAAGAG CAGTCGGGCAGCCAGAGGCACCCTCCACAGAGGC

TCTGGCTCTGCAATCAGGAAAGACACTGCTCTTGGACCCAAGGAAGCTGCAGCTCTCCAGAGCTGGACCCTGAAAGCCTCTTAGGACTCTTGGGAACTAA

TGACCTTACTATGAAGAAGGGGCTTTGAACGGCTGCAGGAAGCAGGAGTGTGGTTCTGGTTCCAGTCCTAGGAGCCACCTGTCCAACCAGAGTTGGAGAT

CTGAGGCCATGGCAGGGTTGAGGGAACCCCACAGTGTGGTGGGAACTTCCTAGGACATGCAAGGTAAAGACTGGATGGCTACTCAATTAAACAGAGTTGT

GGTGTG
Translation
 - UNI33171 -  - UNI32631 - - UNI33171 - MILEDLLMVLSCLSLHALWK - UNI32631 - VRAVPILPLSLVPDTFDDAYVGCSE

EMEEKAGLLLKEEMARHALLRESWEAAQEAWAHRRHKLTLPPGFKAQHGVAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLTRALQLL

RGSGGCSRGPGEVVFRGVGSLHFEPKRLGDSVRLGQFTSSSVDERVARRFGNATFFNLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTGFSQDGAQSIV

TLWSYDQTCSHFNCAYLGG GEKRRGCVSSRA AVGQPEAPSTEALALQSGKTLLLDPRKLQLSRAGP
Transcript ENSMUST00000094128
Sequence
GGCAGTAATCCCTGATCTCAGGCCAGGACTAGGCAAAGTCACCCGAGTACTTGCTGATGAAGGAAGTAAAATCTACAAACACCCAGCTTCAG - UNI33

171 - CTGTTTGTTCAGGATCTGCGATCTGCGAGCGCCTGCCGGCACTTCAGCTCCAGTCAGCCGCAAAGAACCATAGCCCTGGGCCGGGCCGCTCTCT

GTCTCAACTTCTTCCAG - UNI32631 - - UNI33171 - CTTCACCCCTCATCCCTCCTGAGTTCCAGTCCTTGACTAAGGACCCTCCTAGGCTG

AAGGAAGGAAGGTCCTGGAGCCCATCCAAGCCAGCACTCCCCTCCACTGGCTTCATCATCATCAGGGTCCTGCTGTCTCGGGACTCGTCCTAGGATGATT

CTGGAGGATCTGCTGATGGTCCTCAGCTGCCTCAGCTTGCACGCCCTCTGGAAG - UNI32631 - GTTCGAGCTGTTCCTATCCTGCCCCTGAGCCT

GGTTCCAGATACCTTTGATGATGCCTATGTGGGCTGCTCTGAGGAGATGGAGGAGAAAGCAGGCCTGCTGCTAAAGGAAGAGATGGCACGCCATGCCCTG

CTGCGGGAATCCTGGGAAGCAGCACAAGAGGCCTGGGCACACCGGCGTCACAAGCTCACTCTACCTCCTGGCTTCAAAGCCCAGCACGGAGTAGCGATTA

TGGTGTACACCAACTCATCCAACACCTTGTACTGGGAGCTGAACCAGGCCGTACGGACAGGAGGTGGCTCCCGGGAGCTCTACATGAGGCACTTCCCCTT

CAAGGCCCTGCATTTCTACTTGACCCGGGCTCTGCAGCTGCTGCGGGGCTCTGGAGGGTGCAGTAGGGGACCTGGGGAGGTGGTGTTCCGAGGTGTGGGC

AGTCTTCACTTTGAACCCAAGAGGCTGGGGGACTCTGTCCGATTAGGACAGTTTACCTCCAGCTCTGTGGATGAGAGAGTGGCTCGCAGGTTTGGGAATG

CCACCTTCTTCAATCTAAGGACTTGTTTTGGGGCTCCTATCCAGGCGTTGTCTGTCTTCCCTGAGGAGCGTGAGGTGCTGATACCCCCACACGAAGTCTT

CTTGGTCACTGGGTTCTCCCAGGATGGAGCCCAGAGCATAGTGACTCTCTGGAGTTATGATCAGACCTGCAGCCACTTTAACTGCGCCTATTTGGGTG G

GGAGAAGAGACGTGGCTGTGTGTCCTCAAGAG CAGTCGGGCAGCCAGAGGCACCCTCCACAGAGGCTCTGGCTCTGCAATCAGGAAAGACACTGCTCTT

GGACCCAAGGAAGCTGCAGCTCTCCAGAGCTGGACCCTGAAAGCCTCTTAGGACTCTTGGGAACTAATGACCTTACTATGAAGAAGGGGCTTTGAACGGC

TGCAGGAAGCAGGAGTGTGGTTCTGGTTCCAGTCCTAGGAGCCACCTGTCCAACCAGAGTTGGAGATCTGAGGCCATGGCAGGGTTGAGGGAACCCCACA

GTGTGGTGGGAACTTCCTAGGACATGCAAGGTAAAGACTGGATGGCTACTCAATTAAACAGAGTTGTGGTGTGGA
Translation
 - UNI33171 -  - UNI32631 - - UNI33171 - MILEDLLMVLSCLSLHALWK - UNI32631 - VRAVPILPLSLVPDTFDDAYVGCSE

EMEEKAGLLLKEEMARHALLRESWEAAQEAWAHRRHKLTLPPGFKAQHGVAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLTRALQLL

RGSGGCSRGPGEVVFRGVGSLHFEPKRLGDSVRLGQFTSSSVDERVARRFGNATFFNLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTGFSQDGAQSIV

TLWSYDQTCSHFNCAYLGG GEKRRGCVSSRA AVGQPEAPSTEALALQSGKTLLLDPRKLQLSRAGP
Transcript ENSMUST00000106937
Sequence
AATGAACAAGGAGAGATCCTCGTGGGGCTTCGTGGCCTGGGGGTCTGAGGGCCATGGCCCGGCCCAGGGCCACCGGAGAAGAGACCAAGTCTCACAGGTC

TCTCCCCCAACTTTGACTTAGTTCAGATCTTACAGAAAGAACCTATCATCCAAACGAAGGAGAGTTTTGCCCCTCAATCACCCAAGGACTCTGCCAGTTC

AGCTCCCACGCCCCTGTCTGTTGTTGGGGAAGATAGGTGTCGGGTTACCAGTCCAGGGGCTATAGTTAGCCCCGGGGACTTTGTCCAGCTGTTTGTTCAG

GATCTGCGATCTGCGAGCGCCTGCCGGCACTTCAGCTCCAGTCAGCCGCAAAGAACCATAGCCCTGGGCCGGGCCGCTCTCTGTCTCAACTTCTTCCAG 

- UNI32631 - - UNI33171 - CTTCACCCCTCATCCCTCCTGAGTTCCAGTCCTTGACTAAGGACCCTCCTAGGCTGAAGGAAGGAAGGTCCTGG

AGCCCATCCAAGCCAGCACTCCCCTCCACTGGCTTCATCATCATCAGGGTCCTGCTGTCTCGGGACTCGTCCTAGGATGATTCTGGAGGATCTGCTGATG

GTCCTCAGCTGCCTCAGCTTGCACGCCCTCTGGAAG - UNI32631 - GTTCGAGCTGTTCCTATCCTGCCCCTGAGCCTGGTTCCAGATACCTTTGA

TGATGCCTATGTGGGCTGCTCTGAGGAGATGGAGGAGAAAGCAGGCCTGCTGCTAAAGGAAGAGATGGCACGCCATGCCCTGCTGCGGGAATCCTGGGAA

GCAGCACAAGAGGCCTGGGCACACCGGCGTCACAAGCTCACTCTACCTCCTGGCTTCAAAGCCCAGCACGGAGTAGCGATTATGGTGTACACCAACTCAT

CCAACACCTTGTACTGGGAGCTGAACCAGGCCGTACGGACAGGAGGTGGCTCCCGGGAGCTCTACATGAGGCACTTCCCCTTCAAGGCCCTGCATTTCTA

CTTGACCCGGGCTCTGCAGCTGCTGCGGGGCTCTGGAGGGTGCAGTAGGGGACCTGGGGAGGTGGTGTTCCGAGGTGTGGGCAGTCTTCACTTTGAACCC

AAGAGGCTGGGGGACTCTGTCCGATTAGGACAGTTTACCTCCAGCTCTGTGGATGAGAGAGTGGCTCGCAGGTTTGGGAATGCCACCTTCTTCAATCTAA

GGACTTGTTTTGGGGCTCCTATCCAGGCGTTGTCTGTCTTCCCTGAGGAGCGTGAGGTGCTGATACCCCCACACGAAGTCTTCTTGGTCACTGGGTTCTC

CCAGGATGGAGCCCAGAGCATAGTGACTCTCTGGAGTTATGATCAGACCTGCAGCCACTTTAACTGCGCCTATTTGGGTG GGGAGAAGAGACGTGGCTG

TGTGTCCTCAAGAG CAGTCGGGCAGCCAGAGGCACCCTCCACAGAGGCTCTGGCTCTGCAATCAGGAAAGACACTGCTCTTGGACCCAAGGAAGCTGCA

GCTCTCCAGAGCTGGACCCTGAAAGCCTCTTAGGACTCTTGGGAACTAATGACCTTACTATGAAGAAGGGGCTTTGAACGGCTGCAGGAAGCAGGAGTGT

GGTTCTGGTTCCAGTCCTAGGAGCCACCTGTCCAACCAGAGTTGGAGATCTGAGGCCATGGCAGGGTTGAGGGAACCCCACAGTGTGGTGGGAACTTCCT

AGGACATGCAAGGTAAAGACTGGATGGCTACTCAATTAAACAGAGTTGTGGTGTGG
Translation
 - UNI32631 - - UNI33171 - MILEDLLMVLSCLSLHALWK - UNI32631 - VRAVPILPLSLVPDTFDDAYVGCSEEMEEKAGLLLKEEM

ARHALLRESWEAAQEAWAHRRHKLTLPPGFKAQHGVAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLTRALQLLRGSGGCSRGPGEVV

FRGVGSLHFEPKRLGDSVRLGQFTSSSVDERVARRFGNATFFNLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTGFSQDGAQSIVTLWSYDQTCSHFNC

AYLGG GEKRRGCVSSRA AVGQPEAPSTEALALQSGKTLLLDPRKLQLSRAGP
Transcript ENSMUST00000106935
Sequence
ATGATTCTGGAGGATCTGCTGATGGTCCTCAGCTGCCTCAGCTTGCACGCCCTCTGGAAG - UNI32631 - GTTCGAGCTGTTCCTATCCTGCCCCT

GAGCCTGGTTCCAGATACCTTTGATGATGCCTATGTGGGCTGCTCTGAGGAGATGGAGGAGAAAGCAGGCCTGCTGCTAAAGGAAGAGATGGCACGCCAT

GCCCTGCTGCGGGAATCCTGGGAAGCAGCACAAGAGGCCTGGGCACACCGGCGTCACAAGCTCACTCTACCTCCTGGCTTCAAAGCCCAGCACGGAGTAG

CGATTATGGTGTACACCAACTCATCCAACACCTTGTACTGGGAGCTGAACCAGGCCGTACGGACAGGAG GGGAGAAGAGACGTGGCTGTGTGTCCTCAA

GAG CAGTCGGGCAGCCAGAGGCACCCTCCACAGAGGCTCTGGCTCTGCAATCAGGAAAGACACTGCTCTTGGACCCAAGGAAGCTGCAGCTCTCCAGAG

CTGGACCCTGA
Translation
MILEDLLMVLSCLSLHALWK - UNI32631 - VRAVPILPLSLVPDTFDDAYVGCSEEMEEKAGLLLKEEMARHALLRESWEAAQEAWAHRRHKLTLP

PGFKAQHGVAIMVYTNSSNTLYWELNQAVRTGG GEKRRGCVSSRA AVGQPEAPSTEALALQSGKTLLLDPRKLQLSRAGP
Transcript ENSMUST00000106934
Sequence
GTTTGTTCAGGATCTGCGATCTGCGAGCGCCTGCCGGCACTTCAGCTCCAGTCAGCCGCAAAGAACCATAGCCCTGGGCCGGGCCGCTCTCTGTCTCAAC

TTCTTCCAG - UNI32631 - - UNI33171 - GCTGAAGGAAGGAAGGTCCTGGAGCCCATCCAAGCCAGCACTCCCCTCCACTGGCTTCATCATC

ATCAGGGTCCTGCTGTCTCGGGACTCGTCCTAGGATGATTCTGGAGGATCTGCTGATGGTCCTCAGCTGCCTCAGCTTGCACGCCCTCTGGAAG - UNI

32631 - GTTCGAGCTGTTCCTATCCTGCCCCTGAGCCTGGTTCCAGATACCTTTGATGATGCCTATGTGGGCTGCTCTGAGGAGATGGAGGAGAAAGC

AGGCCTGCTGCTAAAGGAAGAGATGGCACGCCATGCCCTGCTGCGGGAATCCTGGGAAGCAGCACAAGAGGCCTGGGCACACCGGCGTCACAAGCTCACT

CTACCTCCTGGCTTCAAAGCCCAGCACGGAGTAGCGATTATGGTGTACACCAACTCATCCAACACCTTGTACTGGGAGCTGAACCAGGCC GCGTTGTCT

GTCTTCCCTGAGGAGCGTGAGGTGCTGATACCCCCACACGAAGTCTTCTTGGTCACTGGGTTCTCCCAGGATGGAGCCCAGAGCATAGTGACTCTCTGGA

GTTATGATCAGACCTGCAGCCACTTTAACTGCGCCTATTTGGGTG GGGAGAAGAGACGTGGCTGTGTGTCCTCAAGAG CAGTCGGGCAGCCAGAGGCA

CCCTCCACAGAGGCTCTGGCTCTGCAATCAGGAAAGACACTGCTCTTGGACCCAAGGAAGCTGCAGCTCTCCAGAGCTGGACCCTGA
Translation
 - UNI32631 - - UNI33171 - MILEDLLMVLSCLSLHALWK - UNI32631 - VRAVPILPLSLVPDTFDDAYVGCSEEMEEKAGLLLKEEM

ARHALLRESWEAAQEAWAHRRHKLTLPPGFKAQHGVAIMVYTNSSNTLYWELNQA ALSVFPEEREVLIPPHEVFLVTGFSQDGAQSIVTLWSYDQTCSH

FNCAYLGG GEKRRGCVSSRA AVGQPEAPSTEALALQSGKTLLLDPRKLQLSRAGP

For any suggestions or comments, please send an email to unitrap@crg.es