Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070564 (Gm484)
Chromosomal location
Chr 7: 52939784 - 52949924 (+)
Description
gene model 484, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2685330]
RefSeq_dna
NM_001033356 
RefSeq_peptide
NP_001028528.2 
MGI
MGI:2685330 
Uniprot/SWISSPROT
Q3UQ22 
Human Ortholog
ENSG00000142233 (AC008888.7-201)
Omim not available
UniTrap UNI32021
Vector Insertion
Chr 7: 52939869 - 52941550
Public Clones IST10211F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107742
Sequence
TCACTCCTCCCGAGAGCCCTCCAAGTGCTTCTCCTACAGAAGAGTGTGGGGATGACCGACTACAGGACACTCTTTTCTTCTCCAG - UNI32021 - G

TGCCGGCTCTACTGTGACCACGCCCATTACCCTCAGCCTCTTGCTCCTCCTTAGCCAGGCCACCTCAGACCCATGCTATGATCCAGGAGGGCGCCCTCGC

TTTTGCCTCCCACCAGTGACCCAGTTGGTTGGCAAGGCAGCAGCCCCCTGCTCTCAGACCTGTGCTCTTCCTGCAGCCAGCCCTGGCCCTGCCTGCAACA

GTAGTCTGACCCTGGACCTGGACGGCTCCTTCCTCTTGACATCTGTGACCCTGCGTTTCTGCACAGCGGGACCTCCAGCCCTGGTTCTTTCTGCTGCCTG

GGCCACTGGGGGGCCCTGGAGGCCACTATGGCGTAGGCCTGCCTGGCCTGGGGCTCTGGGGGGCCCCAAGAAGGTAACCTTTCACTCCCCCCCAGGCCCC

AAGACCAGGATAGTGGCCAGCTACCTCCGTGTGGAGTTCGGGGGAAAAGCAGGGCTGGTGACCACTGGAGTAAGAGGCCGCTGCCAGTGCCACGGCCACG

CTGCCCGCTGTGCCACTCGGGCCCAGCCCCCACGCTGCCGCTGCCGCCACCACACCACTGGCCCAGGGTGTGAGAGCTGTCGCCCATCCCATCGAGACTG

GCCCTGGCGACCTGCCACACCCCAGCACCCTCACCCGTGCTTGC CCTGCCAGTGCCACCCAATTGGAGCAACGGGAGGGATGTGCAACCAGACCAGTGG

CCAGTGCTCCTGCAAGTTAGGGGTCACAGGCCTGACATGCAATCGCTGTGGTCCTGGCTACCAGCAGAGCCGCTCACCCAGGATGCCCTGCCAAC GAAT

TCCAGAGGCAACAACTACCCCTGCTACTACCCCTGTTGCATCTCGATCAG ACCCACAGTGTCAAGGCTATTGCAATGTCTCCGTCAGCAGTGTGCACAT

GAGCCTTCAGAGATACTGTCAGCAGGATTATG TTCTGCACGCCCAGGTTTCAGCGTCGTCGTCGCAGCCGTCTGAGGCGGTGGGCCCCGAGTGGTGGCG

GCTGGCCGTGCACGTGCTGGCTGTGTTCAAACAGCGTGCGTGGCCCGTGCGCCGCGGTGGCCAGGAGGCCTGGGTGCCACGTGCTGACCTAATCTGCGGC

TGCCTGCGCCTGCGCCCTGGCGCTGACTACCTCCTGCTGGGCCGTGCTGCGCAGACCCACGACGACGACAACTATGACCCTGCGCGCCTCATCCTGAACC

GCCACGGCCTCGCGCTGCCCTGGAGACCACGATGGGCCCGGCCGCTGCGGCGACTGCAGCAGAAGGAGCGCGGAGGTGCCTGCCGAGGCCTGCTGCCACC

CACACGGAGCCCTGGGCCCAGGAACTAAAGTGAGCTACTAATGTAAGGTGTGAGTCCCCAGAGCCAATCAGAAGCTTCAGTGCCCGTGACGCCACTCCGC

ATGTGACGTTGCCTACGTTGGGACCGGAAGTGACTGCTTGGACCTGTGAGCCTTATAGGTTATTTGTCACAATAAAGGCTCATGTCTTGTGG
Translation
MTDYRTLFSSPG - UNI32021 - GAGSTVTTPITLSLLLLLSQATSDPCYDPGGRPRFCLPPVTQLVGKAAAPCSQTCALPAASPGPACNSSLTLDL

DGSFLLTSVTLRFCTAGPPALVLSAAWATGGPWRPLWRRPAWPGALGGPKKVTFHSPPGPKTRIVASYLRVEFGGKAGLVTTGVRGRCQCHGHAARCATR

AQPPRCRCRHHTTGPGCESCRPSHRDWPWRPATPQHPHPCLP PCQCHPIGATGGMCNQTSGQCSCKLGVTGLTCNRCGPGYQQSRSPRMPCQR RIPEA

TTTPATTPVASRSD DPQCQGYCNVSVSSVHMSLQRYCQQDYV VLHAQVSASSSQPSEAVGPEWWRLAVHVLAVFKQRAWPVRRGGQEAWVPRADLICG

CLRLRPGADYLLLGRAAQTHDDDNYDPARLILNRHGLALPWRPRWARPLRRLQQKERGGACRGLLPPTRSPGPRN

For any suggestions or comments, please send an email to unitrap@crg.es