Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070644 (Etnk2)
Chromosomal location
Chr 1: 135260411 - 135276892 (+)
Description
ethanolamine kinase 2 Gene [Source:MGI Symbol;Acc:MGI:2443760]
RefSeq_dna
NM_175443 
RefSeq_peptide
NP_780652.2 
UniGene
Mm.52111 Mm.400754 
MGI
MGI:2443760 
Uniprot/SPTREMBL
Q8C0D2 A7MCT6 Q6XRG2 
Human Ortholog
ENSG00000143845 (ETNK2)
Omim not available
UniTrap UNI32503
Vector Insertion
Chr 1: 135275100 - 135275893
Public Clones IST12290E6 (tigm) IST12290E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097030
Sequence
AGTGCTCATGGAGCATGGAGGAGAAGGCGGTGGCCAGCGCCGGCTGCTGGGAGCCTCCAGGGCCCCCGAGGGCCGCCGTCCCATGCTTCAGCGTCACGGT

GGAACAGGACGACATCCTCCCCGGTGCCCTGCGCCTCATTCGGGAGCTGCGGCCGCACTGGAAGCCCGAACAAGTTCGGACCAAG CGCTTCAAAGACGG

CATCACCAACAAGCTATTGGCCTGCTATGTGGAGGAGGACATGCGGGACTGCGTGTTGGTCCGGGTGTATGGGGAGCGCACGGAGTTGCTGGTGGACCGG

GAGAATGAGGTCAGAAACTTCCAACTGCTGCGAGCACACGGCTGCGCCCCCAAACTCTACTGTACCTTTCAGAACGGGCTGTGCTACGAGTATGTGCAGG

GTGTGGCCCTGGGACCTGAACACATCCGAGAGCCCCAGCTCTTCAG GTTGATCGCCTTAGAAATGGCTAAGATTCACACCATCCACGCCAATGGCAGCC

TGCCTAAGCCCACGCTCTGGCATAAGATGCATCGTTATTTCACGCTGGTCAAGGATGAGATCAGTCCCAG CCTTTCTGCAGATGTCCCCAAAGTGGAGG

TGTTGGAACAGGAGCTGGCCTGGTTGAAGGAACACCTGTCCCAGTTGGATTCCCCTGTGGTGTTCTGTCACAATGATCTACTCTGCAAGAATATCATCTA

TGACAGTGACAAAGGTACAGCCCTTCACGCCCCTCAGATGCAGAGGACATAA
Translation
MEEKAVASAGCWEPPGPPRAAVPCFSVTVEQDDILPGALRLIRELRPHWKPEQVRTK RFKDGITNKLLACYVEEDMRDCVLVRVYGERTELLVDRENEV

RNFQLLRAHGCAPKLYCTFQNGLCYEYVQGVALGPEHIREPQLFR RLIALEMAKIHTIHANGSLPKPTLWHKMHRYFTLVKDEISPS SLSADVPKVEV

LEQELAWLKEHLSQLDSPVVFCHNDLLCKNIIYDSDKGTALHAPQMQRT
Transcript ENSMUST00000094555
Sequence
AGTGCTCATGGAGCATGGAGGAGAAGGCGGTGGCCAGCGCCGGCTGCTGGGAGCCTCCAGGGCCCCCGAGGGCCGCCGTCCCATGCTTCAGCGTCACGGT

GGAACAGGACGACATCCTCCCCGGTGCCCTGCGCCTCATTCGGGAGCTGCGGCCGCACTGGAAGCCCGAACAAGTTCGGACCAAG CGCTTCAAAGACGG

CATCACCAACAAGCTATTGGCCTGCTATGTGGAGGAGGACATGCGGGACTGCGTGTTGGTCCGGGTGTATGGGGAGCGCACGGAGTTGCTGGTGGACCGG

GAGAATGAGGTCAGAAACTTCCAACTGCTGCGAGCACACGGCTGCGCCCCCAAACTCTACTGTACCTTTCAGAACGGGCTGTGCTACGAGTATGTGCAGG

GTGTGGCCCTGGGACCTGAACACATCCGAGAGCCCCAGCTCTTCAG GTTGATCGCCTTAGAAATGGCTAAGATTCACACCATCCACGCCAATGGCAGCC

TGCCTAAGCCCACGCTCTGGCATAAGATGCATCGTTATTTCACGCTGGTCAAGGATGAGATCAGTCCCAG CCTTTCTGCAGATGTCCCCAAAGTGGAGG

TGTTGGAACAGGAGCTGGCCTGGTTGAAGGAACACCTGTCCCAGTTGGATTCCCCTGTGGTGTTCTGTCACAATGATCTACTCTGCAAGAATATCATCTA

TGACAGTGACAAAG GCCGCGTGTGCTTTATTGACTATGAATATGCAGGGTACAACTACCAGGCATTTGACATTGGCAACCATTTCAATGAGTTTGCAG 

GTGTGAATGTGGTTGATTACAGCCGGTATCCAGCTCGGGAGACCCAGGTGCAGTGGCTGCGTTATTATCTTGAGGCGCAGAAGGGGACAGCTGCATCCCC

CAGGGAGGTGGAGCGGCTTTATGCACAAGTCAACAAATTCGCTCTG GCATCTCATTTCTTCTGGGCACTCTGGGCACTCATACAGAACCAGTATTCTAC

CATCAGCTTTGACTTCCTCAG - UNI32503 - GTATGCGGTGATCCGATTCAACCAGTACTTTAAGGTGAAACCTCAGGTGTCGGCCTTGGAGATGC

CAAAATGACCAGCCTCCTGTTTCTCCATGTCCTCTTGCTGCCAGATCTGCTCCCCAGGGTGCCTTTCTGCCTTGGAGTTGGGCACCCTGGGGCAAGGCGG

GCACCCACGGAGAAGGCTCCCAGTGGATGCCAATGAAGACCTCATTTTCCTGTTTGGAGGGGCTGAGTCCCAGCATTGGGCGTGGGGAAAACCCTTCATC

CTGCTAGGCTTGGAGAGGAAGTGCCTGCAGATAGTGGGGGGGCCTGGACTGCCCCCCTGTGAGAGCACAGTTGCCAGCCCAGGCACTGCTAGAGCTTGGG

CTGCCTCAGTTTGTCCTTGACCCTTCCTAGTAGGGGAGGGGAGGGTTCATTTCTACCTCTGGTGCCCCACCCCCACCCCAGGCCTCCAACTGAGCCGTAT

GCCTCCTGTGAGAGGTACTGAGCTCCAAGCCAGCAGGAAGCCAACTCTGGCTTGTCATCCTGGGGAGAGGTCCCAGCTGCACTCGCTCCACAGCTCCTCC

AGCAGCTGCCTCATCTGAGGCTGCCAGCTTCTCCAAGCCGGATGCCATCCAGCCACCCCTTCTCCTGGTCCCCTCCTTGTGCTGCTGCCATGCTCCTGCT

AGGTCCCTGCAGAGAAGAGGATGGTAGACCTGGAGCAAGCATGACCTTGGGTACCAGAGGGCAGGCACCAGAGCCAGCATCCTCTTCCACTTCTCTTCCT

TTTATTCTGAACTTAACCAAGATCTTCCCATGTGGAACTGAATGGCGGAAGGCAAGGGGGCAGGGCCTAGGCACCTAGAAGCCAGCACAGTTACCAGGAC

ATGGCCAGATACTGAAGGTGTTGCCAGCTCGGTACCCACCTCCCAGTCCTTACAGGCCTAAGGGAGTCTGGTATAGGCCCCTACTGTGATTCATTTGTAG

ATTATGGTTTTCTGCATTAAAACGTTTGTTTCTG
Translation
MEEKAVASAGCWEPPGPPRAAVPCFSVTVEQDDILPGALRLIRELRPHWKPEQVRTK RFKDGITNKLLACYVEEDMRDCVLVRVYGERTELLVDRENEV

RNFQLLRAHGCAPKLYCTFQNGLCYEYVQGVALGPEHIREPQLFR RLIALEMAKIHTIHANGSLPKPTLWHKMHRYFTLVKDEISPS SLSADVPKVEV

LEQELAWLKEHLSQLDSPVVFCHNDLLCKNIIYDSDKG GRVCFIDYEYAGYNYQAFDIGNHFNEFAG GVNVVDYSRYPARETQVQWLRYYLEAQKGTA

ASPREVERLYAQVNKFAL ASHFFWALWALIQNQYSTISFDFLR - UNI32503 - RYAVIRFNQYFKVKPQVSALEMPK

For any suggestions or comments, please send an email to unitrap@crg.es