Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070858 (Gm1673)
Chromosomal location
Chr 5: 34326086 - 34327658 (+)
Description
gene model 1673, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2686519]
RefSeq_dna
NM_001033458 
RefSeq_peptide
NP_001028630.1 
MGI
MGI:2686519 
Uniprot/SWISSPROT
Q3UR78 
Human Ortholog
ENSG00000206123 (AL132868.24)
Omim not available
UniTrap UNI26025
Vector Insertion
Chr 5: 34326546 - 34326700
Public Clones not available
Private Clones OST145088 (lexicon) OST132719 (lexicon) OST122536 (lexicon) OST122467 (lexicon)
OST113953 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34006
Vector Insertion
Chr 5: 34326790 - 34327546
Public Clones IST12413A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114382
Sequence
GCGCTGCTTGTTCGCGGTTCCTTGAACCGCGGTAAGGGTGGGGTGGTGTCCACGGGGCCCAAGGCAGGGTGGGACTGGGCTAAGCGCACCTGAGCTCGCG

GGACACGTGA GGCGGCCTGGGCTCCTTCTGCCATGGCCCCCGCGCTCAGGTCCTTGCTGTCGCCACGGACTTTACTGCTGCTGCTGCTGAGCCTGGCGC

TGCTGGGCGCCCGCGCCGAGCCCGCCACCGGGAGCGCTGTCCCCGCTCAGA - UNI26025 - GCCGCCCGTGCGTGGATTGCCACGCATTTGAATTC

ATGCAGCGCGCCCTTCAGGACCTACGGAAAACCGCCTACAGCCTGGACGCACGG - UNI34006 - ACGGAGACCCTCCTGCTGCAGGCTGAGCGCCG

GGCTCTGTGTGCCTGCTGGCCAGCTGGACGCTGAAGATCTTTGGCCAGTGATATTCCTTGTCAATAAATGCCTGCTAGCA
Translation
 MAPALRSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQS - UNI26025 - SRPCVDCHAFEFMQRALQDLRKTAYSLDAR - UNI34006 - T

ETLLLQAERRALCACWPAGR
Transcript ENSMUST00000114383
Sequence
GGGTGGGGTCGGCTTGGGCGCATGCGCGCGCGTGCGGGTCGCGGTCGGTCTTCCCGAGTCGCCCGCGCTGCTTGTTCGCGGTTCCTTGAACCGCGGTAAG

GGTGGGGTGGTGTCCACGGGGCCCAAGGCAGGGTGGGACTGGGCTAAGCGCACCTGAGCTCGCGGGACAC GGCGGCCTGGGCTCCTTCTGCCATGGCCC

CCGCGCTCAGGTCCTTGCTGTCGCCACGGACTTTACTGCTGCTGCTGCTGAGCCTGGCGCTGCTGGGCGCCCGCGCCGAGCCCGCCACCGGGAGCGCTGT

CCCCGCTCAGA - UNI26025 - GCCGCCCGTGCGTGGATTGCCACGCATTTGAATTCATGCAGCGCGCCCTTCAGGACCTACGGAAAACCGCCTACA

GCCTGGACGCACGG - UNI34006 - ACGGAGACCCTCCTGCTGCAGGCTGAGCGCCGGGCTCTGTGTGCCTGCTGGCCAGCTGGACGCTGAAGATCT

TTGGCCAGTGATATTCCTTGTCAATAAATGCCTGCTAGCA
Translation
 MAPALRSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQS - UNI26025 - SRPCVDCHAFEFMQRALQDLRKTAYSLDAR - UNI34006 - T

ETLLLQAERRALCACWPAGR
Transcript ENSMUST00000114384
Sequence
GGTGTTTCTATGACGACGACGTCAGGGGGCCCCGGGTGGGGTCGGCTTGGGCGCATGCGCGCGCGTGCGGGTCGCGGTCGGTCTTCCCGAGTCGCCCGCG

CTGCTTGTTCGCGGTTCCTTGAACCGCGGTAAGGGTGGGGTGGTGTCCACGGGGCCCAAGGCAGGGTGGGACTGGGCTAAGCGCACCTGAGCTCGCGGGA

CACGTGAGTAAGGCTGGGCTGTGGGTGGCGGGCTGTGGGTGGGCGTGGCCGGGGCATCACCAGTGGAACGGTTCGGGGTGCAGCCAGGTGCGCGGCGCCG

CTGACCGCTACTCGCTGCAGGGCGGCCTGGGCTCCTTCTGCCATGGCCCCCGCGCTCAGGTCCTTGCTGTCGCCACGGACTTTACTGCTGCTGCTGCTGA

GCCTGGCGCTGCTGGGCGCCCGCGCCGAGCCCGCCACCGGGAGCGCTGTCCCCGCTCAGA - UNI26025 - GCCGCCCGTGCGTGGATTGCCACGCA

TTTGAATTCATGCAGCGCGCCCTTCAGGACCTACGGAAAACCGCCTACAGCCTGGACGCACGG - UNI34006 - ACGGAGACCCTCCTGCTGCAGGC

TGAGCGCCGGGCTCTGTGTGCCTGCTGGCCAGCTGGACGCTGAAGATCTTTGGCCAGTGATATTCCTTGTCAATAAATGCCTGCTAGCA
Translation
MAPALRSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQS - UNI26025 - SRPCVDCHAFEFMQRALQDLRKTAYSLDAR - UNI34006 - TE

TLLLQAERRALCACWPAGR
Transcript ENSMUST00000094869
Sequence
ATGCGCGCGCGTGCGGGTCGCGGTCGGTCTTCCCGAGTCGCCCGCGCTGCTTGTTCGCGGTTCCTTGAACCGCG GGCGGCCTGGGCTCCTTCTGCCATG

GCCCCCGCGCTCAGGTCCTTGCTGTCGCCACGGACTTTACTGCTGCTGCTGCTGAGCCTGGCGCTGCTGGGCGCCCGCGCCGAGCCCGCCACCGGGAGCG

CTGTCCCCGCTCAGA - UNI26025 - GCCGCCCGTGCGTGGATTGCCACGCATTTGAATTCATGCAGCGCGCCCTTCAGGACCTACGGAAAACCGCC

TACAGCCTGGACGCACGG - UNI34006 - ACGGAGACCCTCCTGCTGCAGGCTGAGCGCCGGGCTCTGTGTGCCTGCTGGCCAGCTGGACGCTGAAG

ATCTTTGGCCAGTGATATTCCTTGTCAATAAATGCCTGCTAGC
Translation
MRARAGRGRSSRVARAACSRFLEPR RAAWAPSAMAPALRSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQS - UNI26025 - SRPCVDCHAFEF

MQRALQDLRKTAYSLDAR - UNI34006 - TETLLLQAERRALCACWPAGR

For any suggestions or comments, please send an email to unitrap@crg.es