Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000070972 (2010203O07Rik)
Chromosomal location
Chr 4: 59016065 - 59038445 (+)
Description
DnaJ (Hsp40) homolog, subfamily C , member 25 Gene [Source:MGI Symbol;Acc:MGI:1919679]
RefSeq_dna
NM_001033165 
RefSeq_peptide
NP_001028337.1 
UniGene
Mm.317801 Mm.381402 
MGI
MGI:1919679 
Uniprot/SWISSPROT
A2ALW5 
Human Ortholog
ENSG00000059769 (GNG10)
Omim not available
UniTrap UNI28238
Vector Insertion
Chr 4: 59030541 - 59030695
Public Clones not available
Private Clones OST36283 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095068
Sequence
GCGCGCCGCCGAGCGCCGAGGCTTTCCTGCTAGTGGCGACCGCCTACGAGACGCTCAAG - UNI28238 - GATGAAGAAACACGGAAGGATTATGAC

TACATGCTGGATCACCCAGAAGAATACTATAGCCATTACTACCACTACTACAGCAGGCGCCTGGCCCCAAAAGTGGACGTTAGGGTGGTGATTTTGGTCA

GTGTGTGTGCCATTTCAATGTTTCAG - UNI28238 - TATTTCAGCTGGTGGAATAGCTACAATAAAGCAATCAGCTACCTAGCCACAGTGCCCAAG

TACCGCATCCAGGCAACAGAAATCGCCAAGGAGCAGGGACTGCTCAAAAAAGCCAAAGAAAAAGGGAAAAACAAGAAGTCCAAAGAAGAAATCCGTGATG

AGGAGGAGAACATCATAAAGAACATTATAAAAAGTAAAATAGACATAAAGGGGGGCTACCAGAAACCCCAAGTTCGGGACCTCCTCTTGTTTCAGGTCAT

CCTCGCCCCTGTTCACCTGTGCTCTTATATAGCCTGGTATTGTAGGTGGATCTATAACTTTAACATCAAAGGCAAAGAGTACGGGGAGGAAGAGAGACTT

TACATTATCCGGAAGTCTATGAAGATGTCCCAGTCTCAGTTTGACAGCCTGGAGGACCATCAGAAAGAAATGTTTCTCAAGCGGGAGCTTTGGATAAAGG

AGAATTATGAG GTCTACAAGCAGGAACAAGAGGAAGAATTAAAGAAAAAATTGGCAAATGACCCTCGGTGGAAGCGCTACCGCAGGTGGATGAAGAATG

AAGGGCCTGGACGGCTGACCTTTGTGGACGACTGAAGAAGCTGAGGTGCTGCTGTGCCACACTCTAATTGTGACGACACTTGCATAGCAGTTACTTGGGA

AACACGCCTGCTGCTCTCAGCAGTAGCTAACGTTCAAAACATATGATTAAACAGAATAATGTAGAAATTTCTACTTTCCCTTAAAACTTTATACAGAAGA

CATTTATGATGGTTCAATTTTTATAATCTATTTGTGGATTTTGTTTAAAAAGATTTCACATGGGGACTTATTAGTTGCCATTTAAAATTTTTATATGTTT

AGTTAAATTTGACATGAAATTTATTAGATACCATTTAAAACTTC
Translation
 - UNI28238 - MLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQ - UNI28238 - YFSWWNSYNKAISYLATVPKYRIQATEIAKE

QGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQ

SQFDSLEDHQKEMFLKRELWIKENYE VYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Transcript ENSMUST00000095070
Sequence
GCGGCCGCTGTGCTGGCAGAGCGGCGAGCGAGGCGGGGATGGCGGCGCGGCTCGCTTTGCGCGGGGGACCCGGGGCTGCCGGCCAGCGCCCATGGCTGCT

GCTGGCGCCGCTGCTGCTGGTCCCGCTGCTGGCGCGGCCCGCCGAGGCCCTGGTGGAAGGGCTGTACTGCGGCACGCGCGACTGCTACGAGGTGCTGGGC

GTGAGCCGCTCGGCCAGCAAGGCGGAGATCGCGCGGGCCTACCGTCAGCTGGCCCGGCGCTACCACCCAGATCGCTACCGGCCCGAGCCCGGGGACGGCC

CCGGGGGCGCGCCGCCGAGCGCCGAGGCTTTCCTGCTAGTGGCGACCGCCTACGAGACGCTCAAG - UNI28238 - GATGAAGAAACACGGAAGGAT

TATGACTACATGCTGGATCACCCAGAAGAATACTATAGCCATTACTACCACTACTACAGCAGGCGCCTGGCCCCAAAAGTGGACGTTAGGGTGGTGATTT

TGGTCAGTGTGTGTGCCATTTCAATGTTTCAG - UNI28238 - TATTTCAGCTGGTGGAATAGCTACAATAAAGCAATCAGCTACCTAGCCACAGTG

CCCAAGTACCGCATCCAGGCAACAGAAATCGCCAAGGAGCAGGGACTGCTCAAAAAAGCCAAAGAAAAAGGGAAAAACAAGAAGTCCAAAGAAGAAATCC

GTGATGAGGAGGAGAACATCATAAAGAACATTATAAAAAGTAAAATAGACATAAAGGGGGGCTACCAGAAACCCCAAGTTCGGGACCTCCTCTTGTTTCA

GGTCATCCTCGCCCCTGTTCACCTGTGCTCTTATATAGCCTGGTATTGTAGGTGGATCTATAACTTTAACATCAAAGGCAAAGAGTACGGGGAGGAAGAG

AGACTTTACATTATCCGGAAGTCTATGAAGATGTCCCAGTCTCAGTTTGACAGCCTGGAGGACCATCAGAAAGAAATGTTTCTCAAGCGGGAGCTTTGGA

TAAAGGAGAATTATGAG GTCTACAAGCAGGAACAAGAGGAAGAATTAAAGAAAAAATTGGCAAATGACCCTCGGTGGAAGCGCTACCGCAGGTGGATGA

AGAATGAAGGGCCTGGACGGCTGACCTTTGTGGACGACTGAAGAAGCTGAGGTGCTGCTGTGCCACACTCTAATTGTGACGACACTTGCATAGCAGTTAC

TTGGGAAACACGCCTGCTGCTCTCAGCAGTAGCTAACGTTCAAAACATATGATTAAACAGAATAATGTAGAAATTTCTACTTTCCCTTAAAACTTTATAC

AGAAGACATTTATGATGGTTCAATTTTTATAATCTATTTGTGGATTTTGTTTAAAAAGATTTCACATGGGGACTTATTAGTTGCCATTTAAAATTTTTAT

ATGTTTAGTTAAATTTGACATGAAATTTATTAGATACCATTTAAAACTTCTGTGTGAAGTGTTTCTTCTTCAAGAGTGTTTGCTTATGTTCTCATAATGC

TAATTTTCCTCCTTTCCTGGTCTCCAGTTTTACAAAACAACAACAGAATAATGACAACAGCACTTGATCAGATTATTGTGTCTTTCTGGACACAGTTTCT

CCAGGAGAACCATTCAGTAACATATTGTCCTTACTGTAGTCCTTACAGGTTTGAGCCTACTCAACGTATTCTCTAGGAGAGTATTCTAGAACCTCTGCAC

TTCCTGCCCAGTGATTCTACTCTTGATAAGATCAGAAACTCTCCAGGAGAGTGGGTTACATCATGTCCTTGTGGGATGTTTTCAATTACAGTCTCATTAT

AGGACTAACTTTTCTCAAACATTTCTGCAGAGGGGACCTTGTAAAAAGGTCTTTTATACCACCAACTTGCTGCTTCCCTCCCTCCCTCCCTCCCTCCCTC

CCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTCCCTGCATTACTTGTGTGATTAAACTGTAATGCACATGAGGGTCTTATGTGCATTTG

CACTAGAAAGAAGACAGGCAATGCTATGCTGCTGTCATCCTCTAGGGAATAAGTGTGTCTTTATACTTATGGAAGTGAACGGAAATGGCAGAATGGCTGA

GTCAAACCTGATACTCTACCAAAGTACCATATACACTCATATACAGTGCTCTGTTCAAGATCTACCCTACTGCTTCATATTAATAAAATGGTTGTGATGC

ATCATGCTGCCTGGTAGGCTATGTAAAGATTAACATAATGCTTTTGTAGCATATACTTTTAAAAGATTAGTGTAGCATAATAGCTATGAAGGATTTCTTT

TTTTTTCTTTCTCTCTCTCTTTTTTTTTTTTTTCTTTTTTGGTTTTTTGAAGCAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGA

CCAGGCTGGCTTCGAACTCAGAAATTCATCTGCCTCTGCCTCCGGAGTGCTGGGATTAAAGGCGTGCGCCACCACGCCCGGCTGAAGGATTTATTTCAGC

CCAGGGACTGGGTAGCTTGGTTGATAAAGTGCTTCCTTGCAAACAGTGGGGACTGACTTTGCAGCCCTCCCCACGCACATACCATCTCATGTAAAATATG

CCAGGCAATGGTGGCCTGCTCATACTGAACCTGTCTTAGAAATCAAGGTGGAGAGCACCTGAAAATGACAATCAAGCCTGTCTTCTGGTCCCCACATACA

CCCACACACTTGTGTATCTGCACACACACACATACACACACACACACACAAGCACACAGAGCTCAGTCTAGATTACGTGCATGAGTCTACCCTTGCCAAT

TAGCCAAAAGACTTAAGATCAGTTATTCTAATGTGATTGAATAATTTCAATTGATAATTACAAGAATAGAAGTTGACCAGGCTGTCAGTAGGACTCTTTG

TAGCTCTGTGCTTCTGAAATACTATAATTTTTAGAGTTCTGTAAACTGTAGTTGGAAATGTTTGTGTGTTCATTCTTCTTTTTTTCTTTTCTTTTTTTTG

AGGCAGGGTTTCTCTGTGTAGCCCTGGCTGTTCTGGAACTCACTTTGTAGACCAGGCTGACCTCGGTGTTCATTATTCTTTAGGGTTGTGGAGAATCAGC

GTTAGCACCTGTCACTCATTATTATCTAAGAACAAATTTATGTCATAAGGAACAGAAAGAGATACCAGTACTAGTGTATCTCACCATTTTCCAAACATCT

CTGATTGTTTGTATTTTTCTGGTACTCTGACAAACACCATGCCAGGAAGCAGTAGGTAGAGGGAAGGACTTCTGTGGCTTACAGTTGCAGGTTACAGTCC

ATCATTCTGGTGAAAGGCTAAAGCTCAAACACCTCGTAATATCATACCCACAAGAGTAAGGAAAGAATATATGTATCTTTGCCTCTCGTGTTGTTCAGCA

TTTCCTTGCTAGGGAATGGTACTGCTGGCTGGGGCTTCCTACATCAATTATCAAGGCGATCCCTCAGACATACCCACAGGCCAACCTCAGTGAGGTTCTG

TTCACAGTTAGTTTGAAGTCATCAGCTTGACAGTAAAGACTGACTAGCACACCTCTTCATAAGGAGAAGAGAGAGATGTTCAGCCAGTGAAGACTCAGAC

TATCTTTGGATATTCTTTTGTCTGTCTTTTTTTATTTCTGTATTCTATTTCTAGAATTGTCCACTGAGGGCTGCTTATGTGAGAGCTTGGGCACAGTCAT

TGCATGAATCAAGGTGGACTCTACAGAAAGATGGAGGGTTTTCCCCTCCCCTCTGTTCACTGTGCTTCAAATTCCCAGGATGAAGGAAAGAAAGGCCGTT

GCTTACAGTAATCACTGTACTTCACTGCACTCTTCCACCAAAATGAAATCTCTTCGTTTTAGAGACACCCAAGAAGACTTGAGGCCCTTACAGCCCTGTT

AGTGCAGGGAGGAGGGGGTGGGGCTGTCTGAGCATGGCTGTTCATTGCTGCCTGTTTTTCATCGATTCGTGTAATTGAAGTCTTCAAAATACCTTGTGGG

TTTTATTCATATAAATGCCTTCCTTACAGTT
Translation
MAARLALRGGPGAAGQRPWLLLAPLLLVPLLARPAEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLL

VATAYETLK - UNI28238 - DEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQ - UNI28238 - YFSWWNSYNKAI

SYLATVPKYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGK

EYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYE VYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD

For any suggestions or comments, please send an email to unitrap@crg.es