Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071224 (AC121839.3-202)
Chromosomal location
Chr 13: 99049893 - 99077047 (+)
Description
not available
Human Ortholog
not available
Omim not available
UniTrap UNI36572
Vector Insertion
Chr 13: 99072583 - 99075265
Public Clones IST14844B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31739
Vector Insertion
Chr 13: 99075410 - 99075675
Public Clones IST14096B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095522
Sequence
AGAAAAAGAAGTGGCAAACTGCAGATCGGCAGGAATAAAAG GGGTTCCTAGAACAGGGAGCATTGTTCACCAAAGCCCTGGCCTTCCAGGATTCATGGC

TGCTCACAGGGTTCATCCTCAAGGCCAG GCGACAGGAGTATCTTTTCTTCCTACTGCAGCAGATGTGCCTTTGGATCGGCATCGTAAAAAAG GTCACA

GCTGCCTTCCCACCAGAAAATGTCTTCTGACTTCTTGCGGGGTATTCCTCGTGCTTGGCGTTGTTGCCGCTGCGATTGCTGTTGGGATCATCTTCGGGAC

ACCTACAAAACCTGCAA - UNI36572 - GTTGGACATATCACCAATGCAGGACAGATTCACAGCAACCAGGGTTCCTGTGTGAGGACCGCACAACTT

GCTTGCCACCATCTCTGCTTTGTGATGGCAAGATGGACTGCCGTGACGGATGGGATGAAGCTGCTGCCTCCTGTG - UNI31739 - GTCAAATGCCC

GACAGTCTCCCACAAAACTTGATTTTCAAGTGTCCCAACCAGAAGACATGGACGTTTGTGGACAGGGTGTGTGACACCAGGAACGACTGTGGTGACTGCT

CAGATGAATCAG TTTCACGGTGCCCAGAGTGCTCCGGCTGGAGATGTGAGACCGTTTTCTTCGCGGACTGTGCCTGCATTCCCAGAAGTCGCTGCAGAA

ACGGCATCCAAGACTGTGCCGACTGGAGTGATGAAAACCTGTGCGACTAG
Translation
 MAAHRVHPQGQ ATGVSFLPTAADVPLDRHRKKG GHSCLPTRKCLLTSCGVFLVLGVVAAAIAVGIIFGTPTKPAS - UNI36572 - SWTYHQCR

TDSQQPGFLCEDRTTCLPPSLLCDGKMDCRDGWDEAAASCG - UNI31739 - GQMPDSLPQNLIFKCPNQKTWTFVDRVCDTRNDCGDCSDESV VS

RCPECSGWRCETVFFADCACIPRSRCRNGIQDCADWSDENLCD

For any suggestions or comments, please send an email to unitrap@crg.es