Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071252 (2210408I21Rik)
Chromosomal location
Chr 13: 77274860 - 77473638 (+)
Description
RIKEN cDNA 2210408I21 gene Gene [Source:MGI Symbol;Acc:MGI:1919621]
RefSeq_peptide
NP_001074822.1 
UniGene
Mm.81475 
MGI
MGI:1919621 
Uniprot/SWISSPROT
Q5FWD2 Q3UPC7 
Uniprot/SPTREMBL
B2RXR4 Q3TNF8 
Human Ortholog
ENSG00000175483 (AC117521.2)
Omim not available
UniTrap UNI18689
Vector Insertion
Chr 13: 77274892 - 77314113
Public Clones (sanger) D086H02 (ggtc)
Private Clones OST417640 (lexicon) OST415981 (lexicon) OST276656 (lexicon) OST249676 (lexicon)
OST230586 (lexicon) OST205216 (lexicon) OST126957 (lexicon) OST115294 (lexicon)
OST111123 (lexicon) OST103577 (lexicon) OST79589 (lexicon) OST68953 (lexicon)
OST57156 (lexicon) OST38793 (lexicon) OST33867 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24406
Vector Insertion
Chr 13: 77314246 - 77322861
Public Clones not available
Private Clones OST221922 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30485
Vector Insertion
Chr 13: 77323031 - 77331814
Public Clones CMHD-GT_263E6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31039
Vector Insertion
Chr 13: 77384624 - 77393383
Public Clones IST13735E11 (tigm) IST14257B11 (tigm) IST10320H9 (tigm) IST14154C12 (tigm)
IST10528H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095588
Sequence
CCTTGCAGGATCAGCGCCATAGACGGAGATTG - UNI18689 - AATGGATGCATTACAGGAATATTCCCATAATTCATTTGACCTGCAGTGTCTGTT

AAATTCGTTTCCCGGAGATTTGGAGTTTAAGCAGATCTTCAGTGACATTGGAGAACAGATGGAGCAAAATGCTGCAAG - UNI24406 - TATAGAAC

ATTGCATTGAAGAAATACAGTCTGAAGTAAACAAGCTCTGTCCAGATGCACAGCTACAAACAACAAGTGACTGCTTCAAATGGCTAACTAGTTATAATTA

TAATTTATCTAAGTCACCATCCATTTCCCATGGAGATTTAATAAACTTCCTCAAAACAATG - UNI30485 - AAAGATTTATTGAATAATGAAGACA

ACCATGAAGAAATGATTCTGGATTTACTCTGGGACCTCTCCTGTCAAAGCAGCATCTCTTTCCTGTCCTCTCTGGGTGGGACAACCTTCTGTCACCTGTC

CAGGACTTCCATACATTCTGTTGAAGATTTCTCCTCTGTGGATGTCAAGTCTGTTTGGGATGATGTAAGATTACATCTTCGACGATTCTTAGTAAACAGG

TTAGAAAGATATAATGAGATAAACAATTCACAGCAAAAAATTGAACTGAAAAGTCAATGTATGAAGCAATTCCTCTTGCTCTACTCAGAATCAGAAGTGC

TTGTCAAGTACCAAAGCATCCAGAAGAGACTGCTGGATACATTTCTGCAAGACTCCTTTCCTTCGTGCAACAGAGAATCAGATTTAGAAAGAATTGTGTG

TGGATACCAAAGTACTATGCTCATGTTATATTCAATGATAAAAGAGGATTTTAATGTACTATGTGAAATTTTAGCTCCATCATCACTGGTGCAGTTCTTT

AATGAAACTTACCTGGATACGGTTACAGAAGAAATGACAAAAATTCTTGAATATTTTTGTGAGCTGCAGTTCAAAGAAAATGCTGTTCCTGTAGTTAAAA

CAAGCAAGAGCTGCAACAAGCGCAGAGGAGCAGTGCATGCTTTGG TCAGCCCTGAATGCTCACAGAAGGAAAGACGCCCTTCTCTATCCTTAGAAGAAC

TCAGATTTTTATCACAGCTAACAGAATCCTTTGTGAAGCTGGAAAACAGCATTCAGGAGCTGTTTGCAGAAACACTTTCATTGCTTCAGATGCCCAGGAG

TTCTCCAG - UNI31039 - GAATATTGGAGAAATCTAAGAAGGAAGTCATGGTAGAGAAGCTTATAGCAAATGAAAACAATAAACCACCAGAGGCAT

TATTACCAGTAAAAGAG GCTACTTTACTAGAGTTTGGCTGGAGAAATGCTTTTAAAGAAGTGCCTCTTGCCATAGCACACTGCATATCTGCAGCCATTG

AAGGGTTTTCCACTCAAGTTCTCCAGCAGGAACAAACTGAAAGGACCTCATCTGTGAGCTACACTATAAACCTTGTAAATGTCCCACAACTTTGTCCAGA

AGGTCACATATTTCCAGAGGAGGAGCAACCAAAGAGAGTTGCCAAG TTTTGTTCTGACATCATAGAAAAGCTTGATACAATGCTTCTCCTGGCCCTGGC

ATGCCGAGATGATTCTCCTCAGGAAATCAAAGAGAACCTGGTAGAGGCCTACAGTAAAGTGGCAACAGCTGTCCTGGAAAGACTGCAGGAGAGAGGAAAG

GAGGTTCCTTCCCGAGCACCACTGAAGAACCTGCACAGCATCCTGTCCTCAGCAACGTATGTCTCTCAGCGGTTCACTCACTATGATAATCTGATGAAAG

AGACAACTAAGAA ACCCATATTCCTGGTGCCTGTCCAGCGCTATCAGGAATTCATCAACACTGTCCAGTTTCAGGTTACGGACTACTGCGCCAGAGTTT

GTGCTATGAGCATTTTACAGGATGCTGAGAGCCACCACTGGGATGACTACAAAGCTTTTTATGAG GGGGAAAGATGCTCCTTCGCCATCCAGATGTGGC

ATTACTTCAGCTTGGCTCTGCATCATGATCTCTGGACCATACTGCCCCCTAAGCTGGCCCAGGAGATTCTAGCAGAGATGCTGGAGAAATCCTTGGGTCT

ACTTGCCTCCAGATATGCTCGGGCCCACCCCAGTCCTAAGAGAACTGCACAGATAAG ACTTGATGTCATGGCAATCTTAATATTCACTGAGAACATGTT

ATGGTCCATTTGTTCTTCTGGACAGGAAATTTTGAATCCTCATAAATTTAACAACCATAAAATTTTTAAAATTCATACTCATTGCAACAATCTCTTTACA

ACATTAGCAATTTTGACATCACCATTAACCGAATTATATAA GACTTTTCAGCATGGTGTCGATGAATCACCTTCAAATTCCTTAACTCCATTGTTTAAC

CAGCCATTACACTGGATTTCATGCATGTCACAGTTCTACCCTTCTCTCCTCAG GCCTCCATCAGTGGGTGGACTGACAGCCCAGGGTCAGTTGAAACTG

CTCTTATCGCAGCCTTGCTGTAAGTGGAACCTTCTTCTGGACACCCTGCTTCACAGTGGCGGCCTCATACCGAGAATCCTGTTGAAAAGTTCAA AACAA

GCTGCTGGCATGGAGAGTAAGCAGAGTGCAGGTGGTAGCCTGGTGGGCGCCATCTTTGAAGTTCTGTACCATTGTCATTTGTCCTCACAGACATTTGGAA

ATGTTTTTATGAGTCACATGGAAGAAGAACAACTATGGGACTTTTTATTCAACATTCCAG TCTCATCGTTCACAGAGTCTCAGCCAGAAGTCATCCACT

GTCTGAGACTGGCACTGATGGACTCTGTAAAGGACACTGTGCAACAGATAATATCCATCATGAGATGTCGGAGAAACAGCGAGACAAACCTAAACAAGCC

CCGTGTTCCTGATCATCTGCTTCAGAGCATTCCACAAGGATGGAATTATATCCCAAGAGATTCCAGAGGGAAAGAGTCAAATAAAG GCATCACGGAGCT

TGCTGCTCAGGCAGTGTCTATTGTCCTCAGCAAGTTACCTACAGTGATTGCATGCTTGCCTCCCACAATTAAATACTTCTTTTTTCTGTCTGAGAGAAAA

ATGTCAAAAAATTTGGCTGAATTGAAGAAAGCTGGCCTGCTTGTCTGGAACTTGATTATAATTATATGTCGGATATTTGAGGATGGGAACACCGTGGAAC

GTTTAACAGGTTCCTCCCTTGACAGATGGAGTAAGGAGAAACTGGGTTTAATTTGCTTGTGTTTGGAAAGTATCCTGGGAAAGCAAAGCAATCCTAGTCA

GCTGACCCAAAAGGTCATCCTGAGCATCGAGCGGCAAAAACCCAACTGGATGGAGCAACAGCTTCTGAAAGCAAGGACACTGAGCATCCAATG TGCATT

CACGAGGATGGAGGAAAACTCAGGCTCAGAAGGAGAAGCTGCTCTTGAACTGACTGAGCAGAAAACAAATGCGATGGTCCTGGATCTCTGCCACAAACCA

GGTGGCAGCAAGTACCTGCAGCAAATTTATCACATCATGCAGCTCAATGAG GAATATTTAAAAGAACAACTGTTTGCTATGAATGGCTCAGAAGAAAAG

CCATTACTCATCAGACCTTTGAAGGTAGCCTTGAGGGATGAAGATCAGCCTCCTGCTTTTAACCCTTTTCATGTGCATAAGGTGGTCAGTGAAAGCATGC

TAGATCAG GTGGCCACAGTGACATGGTGCTGCGACTGGTCAAACTTGCTGCCAAATTACCTAGGACTGAATAAGATGACCTTCGGTGCACTATTCAAAA

ACAGGTGATAAGACTGAG
Translation
 - UNI18689 - MDALQEYSHNSFDLQCLLNSFPGDLEFKQIFSDIGEQMEQNAAS - UNI24406 - SIEHCIEEIQSEVNKLCPDAQLQTTSDC

FKWLTSYNYNLSKSPSISHGDLINFLKTM - UNI30485 - KDLLNNEDNHEEMILDLLWDLSCQSSISFLSSLGGTTFCHLSRTSIHSVEDFSSVDV

KSVWDDVRLHLRRFLVNRLERYNEINNSQQKIELKSQCMKQFLLLYSESEVLVKYQSIQKRLLDTFLQDSFPSCNRESDLERIVCGYQSTMLMLYSMIKE

DFNVLCEILAPSSLVQFFNETYLDTVTEEMTKILEYFCELQFKENAVPVVKTSKSCNKRRGAVHALV VSPECSQKERRPSLSLEELRFLSQLTESFVKL

ENSIQELFAETLSLLQMPRSSPG - UNI31039 - GILEKSKKEVMVEKLIANENNKPPEALLPVKE ATLLEFGWRNAFKEVPLAIAHCISAAIEGF

STQVLQQEQTERTSSVSYTINLVNVPQLCPEGHIFPEEEQPKRVAK FCSDIIEKLDTMLLLALACRDDSPQEIKENLVEAYSKVATAVLERLQERGKEV

PSRAPLKNLHSILSSATYVSQRFTHYDNLMKETTKK KPIFLVPVQRYQEFINTVQFQVTDYCARVCAMSILQDAESHHWDDYKAFYE GERCSFAIQMW

HYFSLALHHDLWTILPPKLAQEILAEMLEKSLGLLASRYARAHPSPKRTAQIR RLDVMAILIFTENMLWSICSSGQEILNPHKFNNHKIFKIHTHCNNL

FTTLAILTSPLTELYK KTFQHGVDESPSNSLTPLFNQPLHWISCMSQFYPSLLR RPPSVGGLTAQGQLKLLLSQPCCKWNLLLDTLLHSGGLIPRILL

KSSK KQAAGMESKQSAGGSLVGAIFEVLYHCHLSSQTFGNVFMSHMEEEQLWDFLFNIPV VSSFTESQPEVIHCLRLALMDSVKDTVQQIISIMRCRR

NSETNLNKPRVPDHLLQSIPQGWNYIPRDSRGKESNKG GITELAAQAVSIVLSKLPTVIACLPPTIKYFFFLSERKMSKNLAELKKAGLLVWNLIIIIC

RIFEDGNTVERLTGSSLDRWSKEKLGLICLCLESILGKQSNPSQLTQKVILSIERQKPNWMEQQLLKARTLSIQC CAFTRMEENSGSEGEAALELTEQK

TNAMVLDLCHKPGGSKYLQQIYHIMQLNE EYLKEQLFAMNGSEEKPLLIRPLKVALRDEDQPPAFNPFHVHKVVSESMLDQ VATVTWCCDWSNLLPNY

LGLNKMTFGALFKNR

For any suggestions or comments, please send an email to unitrap@crg.es