Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071281 (Zfp71-rs1)
Chromosomal location
Chr 13: 67806246 - 67830019 (-)
Description
zinc finger protein 71, releated sequence Gene [Source:MGI Symbol;Acc:MGI:107769]
UniGene
Mm.440123 
MGI
MGI:107769 
Uniprot/SPTREMBL
Q60915 Q8BY64 Q91W94 
Human Ortholog
not available
Omim not available
UniTrap UNI26291
Vector Insertion
Chr 13: 67811945 - 67829997
Public Clones IST11580G10 (tigm) IST11785F9 (tigm)
Private Clones OST126792 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9477
Vector Insertion
Chr 13: 67811348 - 67811817
Public Clones RRD303 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073157
Sequence
GGTTTGGATCCCTGACATGGAG - UNI26291 - GAAATGCTGTCATTCAGGGATGTGGCCATTGATTTCTCTGAAGAGGAGTGGGAATGCCTAGGTC

CTGCTCAGTGGAATTTGTACAGGGATGTGATGCTGGAGAATTACAGCCACCTTGTGTTCCTGG - UNI9477 - GTCTTGCTTTGTCTAAGCCATATC

TGGTCACATGTCTGGAGAAAATACAAGAGACTTCAGGTGTGAAAAGAGGAGGAGCTCCATTTATGCTCCCAG GAGGAAAATGCTATACGTGCACAGAGT

GTGGCAAAATCTTTGAGTGGAAAAAAGTGTTTCAAAATCACCAGATGCTTGATTTACGAATGAATCCCTACAAGTGTGAAGAATGTGCCAAGTCTTTCCA

TAGTCCATCATTAAGTTCTAAAGAGAGCAGAATTCATACAGGAGGGAAACCTTACAAATGTGAAGTTTGTGGCAAGGCCTTCTGCATTCCATTATTACTT

TCTAAACACAAGATAATTCATACAGTAGAGAAACCCTACAAGTGTGATATATGTGGCAAGGCCTTCCAATATCCATCAAAACTTTCCAGACATAAACAGA

TTCATTCAGAAGAGAAACCATACAAGTGTGAAGTATGTGGAATGGCCTTCCACTTTCCATCATTACTTTTGGTACACAAGCGAATTCATACAGGAGAGAA

GCCATACAAGTGTGAAGAATGTGGCAAGGCCTTCCGCAATTCATCATTTCTTTCTAAACACAAAATAATTCATAGAGGAGAAAAACCCTACAAGTGTGAG

GTATGTGGCAAGGACTTCCATTATCCATCAAGACTTTACAACCATAAGAAAATCCATTCAGGAGAGAAACCATACAAGTGTGAATTATGTGGGAAGGCCT

TCTGTTTTCCTTCATCACTATCTAAACACAAGAGAATTCACACAGGAGAGAAACCATACAAATGTAAAGAGTGTGAAAAGCCCTTCTGCTATCTGTCCTC

ACTTTCTAAACACAAGATCATTCATACAGGAGAGAAACCCTACAAGTGTGACTTATGTGGCAAGGCCTTCCGTTATCCATCATTACTTTCTGAACACAAG

GTAATTCATACAGGAAATAAACCCTACAAGTGTGAAGTATGTGGCAAAGCCTTCCATTTTTCCTCACAACTTAAAAAGCATAAGAAAATTCATGGGGCTG

GAGACATGGCTCAGTAGTTAAATCAACTGTCTGCACTTTCAATTGTGCTGTCCTGAGTTCAATTCCTGGCAACTACATGCTGGCTCACAACCATGTATGA

TGGAATCTGTTTCCCTATTCTGGTATGTAGGGATACATGCAGGTAGAGAACTCATACACATAAAATAAATATGTTATTTTAAAAATTGATGGTATGTTAC

CTGGTGCCTAAAAAAGAATACCAGAGAACAACCAACGCTACTAATGGAATAATGTGGCAAGGACTTCCAATGACCAGCACTATTTTCTAACCCCAAGAGA

AATCATATGGGAAAGAAACCCTCCAATTAGGAAGTATGTAGCCTGATCCTCTATTGTCCATAATTACTTTCTGAACACAGGAGAATACACACAGGTTAGA

AACCCTACATTTATTAAGTGCAAGTCAACTCCTTTAGAATTTGCCAGTTTTTTCTACTCGTTTTATGTGGAAAAGCCTTTTCTACAAATATACACCAGTG

TTTACACAAATTAACTCATAGTGTGGTGATATTTACAAATACAAAGAATATGTCCAAGTGTTCAAAAAAAAACTTTAGGGATCATCAAAAATTCATTTTT

GAGGAAAGCAGAAAACCCGGTCTGACCAGGGTCACAAGTCCCTTCCAGTCGGCCCAAGCACCGGGTCACCTTGGGCTCGAAGTCCGCAGGCACCCCCAAG

GTCCCTAGGGACACAATGAAACTAACAAAAGTTATGAACATGGATTTAACAGATATCTACAGAACATTTTATCCTAAAGCAAAAGGATATACCTTCTTCT

CATCACCTCATGGTACCTTCTCCAAAATTGACCATATAATTGGTCACAAAATAGGCCTCAACAGATACAAAAATATGGAAATCAGTCTGGCAGTTCCTCA

GAAAATTGGACATAGTACTACCAGAGGGTTGTCCAATACCTCTCCTGGGCATCTATCCAGAAGATGTTCCAACTGGTAAGAAAGACACATGCTCCACTAT

GTTCATAGCAGCCTTATTTATAATAGCCAGAAGCTGGAAAAAACCTAGATGTCCCTCAACAGAGGAATGGATACAGAAAATGTGGTACATTTACATAATG

GAGTACTTCTCAGCTATTAAAAAGAATGAATTTTTGAAATTTCTAGGCAAATGGATGGACCTGGAGGGCATCATCCTGAGTGAGGTAACCCAATCACAAA

AGAACTCACATGATATGTACTCACTGATAAGTGGATATTATCCCAGAAATTTAGAATATCCAAGATACAAGATACAATTTGCAAAACACATGAAACTCAA

GAAGAACAAAGAGCAAAGTGTGGAGACTTTGCCCATTCTTAAAATTGGGAACAAAACACCCATGGAAAGAGTTACAGAGACAAAGTTTGGAGCTGAGATG

AAAGGATGGACCATCTAGAGACTGCCATACCCAGGGATCCATCCTATAATCAGCCACCAAACGCTGACACCATTTCATACACTAGAAAGATTTTGCTGAA

AGGATCCAGATATAGCTGTCTCTTATGAGGCTATGCCAGGGCCCAGCAAATAGAGAAGTGGATGCTCACAGTCAGCTACTGGATGGATCACAGGGTTCCC

AATGGTGGAGCTAGAGAAAGTACCCAAGGAGCTAAAGAGGTCTGCACCCCTATAGGTGGAACAACAATATGAACTAACCAGTACCCCCCAGAGCTCGTGT

CTTTACCTGCATATGTATCAGGAGATGGCCTAGTCGACCATCATTGGAAAGAGAGGCCCATTGGTCTTGCAAACTTTATATGCTTCAGTAAAAGGGAACG

CCAGGGCTAAGAAGTGGGAGTGGGTGGGTAGAGGATTGGGAGCAATGGTATAGGGGACTTTTGGGATAGTATTGGAAATGTAAATGAAGAAAATACCCAA

TGAAAAAATTTTTTTAAAAATTAAGAGAACTGTAAATAAATAAATAAATAAATGTCATCAACCCATGAAGAAAAAAAATTTCATTTTGCAGAGAAAACAT

ATAAATCTAAAGAATGTGGCAAATATCAGAAGTTACAAAGCATGATCTGAATACCGGATAATTCCTACTGGAGAGAAACATTACAATTGTGGAGAATGTG

GCAAAACCTATTACCAGTCTTGTGGTCTTAAACAACATTCAAAAATTCACCTATGAGAGAAACCACACGAGTGTGGAGAATGTTCCAAGGTCTTTTGTAC

TTACTAAGAACTTGTGAAACACCTCATAATTCATACAAAACTGAAATACCACATGTGGAAAATGTTGCAAACCTTTATTAAACTTTCTTATATTTCTCAA

AGTAATTCAAACTGGAGTGAAATAATAGAAATGTTAAATATTCATAATATGTTAACACTTCTTCAGACACTAAAAGCTCCTTCCTGAATAAAAACCATAT

AAGATTGAGGAATGGGGCAAGTAAAGACTTTGGAATCATTCACACAATCATGCCAAAAGTAGAGCTGTCAGATTATGTGTTTGTTCTCCGCATTTAGGGC

TGATCTTTCCTGGGTGTCTTTTGTTTCTTCTGTTTTAGAATCAGAACACATATTCTATACCAGTGAGTAGTAAAAATAGTGTCTTGTTCTTATGTTGTAA

GAGCTCACACATAAGAGATTGCCTTGAGTGTCATGTGACACATGGACCGTGAGTTTTCATAGTGTTGTAATTATTAAATCTTTTATGGACCTTT
Translation
ME - UNI26291 - EMLSFRDVAIDFSEEEWECLGPAQWNLYRDVMLENYSHLVFLG - UNI9477 - GLALSKPYLVTCLEKIQETSGVKRGGAP

FMLPG GGKCYTCTECGKIFEWKKVFQNHQMLDLRMNPYKCEECAKSFHSPSLSSKESRIHTGGKPYKCEVCGKAFCIPLLLSKHKIIHTVEKPYKCDIC

GKAFQYPSKLSRHKQIHSEEKPYKCEVCGMAFHFPSLLLVHKRIHTGEKPYKCEECGKAFRNSSFLSKHKIIHRGEKPYKCEVCGKDFHYPSRLYNHKKI

HSGEKPYKCELCGKAFCFPSSLSKHKRIHTGEKPYKCKECEKPFCYLSSLSKHKIIHTGEKPYKCDLCGKAFRYPSLLSEHKVIHTGNKPYKCEVCGKAF

HFSSQLKKHKKIHGAGDMAQ

For any suggestions or comments, please send an email to unitrap@crg.es