Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071285 (Zfp87)
Chromosomal location
Chr 13: 67616720 - 67627084 (-)
Description
zinc finger protein 87 Gene [Source:MGI Symbol;Acc:MGI:107768]
RefSeq_peptide
NP_573491.2 
UniGene
Mm.472956 
MGI
MGI:107768 
Uniprot/SPTREMBL
Q60914 Q8C1B9 Q8K2A4 Q9JIB9 
Human Ortholog
not available
Omim not available
UniTrap UNI21574
Vector Insertion
Chr 13: 67622256 - 67627012
Public Clones not available
Private Clones OST325558 (lexicon) OST171529 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8822
Vector Insertion
Chr 13: 67619049 - 67621561
Public Clones TEA197 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000004225
Sequence
GACGTTTGTCTTCCCCTAAGTTAGCGGTGCTGTGTCCTGCTCCTCGCTCTCGATCGGATCTCTGACATGGAG - UNI21574 - GAAATGCTGTCATT

CAGGGATGTGGCCATTGATTTCTCTGCAGAGGAGTGGGAATGCCTGGAGCCTGCTCAGTGGAATCTGTACAGGGACGTGATGCTGGAGAATTACAGCCAC

CTTGTGTTCCTGG GTCTTGCATCCTGTAAGCCATACCTGGTCACATTTCTGGAGCAAAGACAAGAGCCTTCAGTTGTGAAGAGACCAGCAGCTGCCACC

GTGCACCCAG - UNI8822 - GGGGGAAGCCCTATAAATGTCAAGAATTTGACAAGACCTTTGATTGGAACTCACTCCTTCTTCAGCGCCAGAGAGTT

CATCCTGTGGAGAAGCCCTACAAATGTGAAGAATGTGGGAAGGTCTTTAGTGCTCACTCGGCACTTTCTATTCACCAGCGAATCCACACCGGAGAGAAAC

CCTACAAGTGTGAAGAGTGTGGCAAGGCCTTCAGTACTCGCTCAGCACTTTATATACACAAGAAAATCCACTCTGGAGACAAACCCTACAAGTGTGAGGA

GTGTGCCAAAGCCTTTTATTTCCCTTCATTGCTTAAGCAACATCAACGAACTCATTCTGCAGAGAATCTCTGCAAGTGTGAGGAGTGTGGCAAAGCCTTT

TATTTACCTTCATTCCTTAAGCAACATCAAAGAATTCATTCTGCAGAGAATCCTTACAGGTGTGAAGAATGTGGGAAAGCCTTTTCCTATCCCTCAACCC

TAAAGCAGCATCAAAGAATTCATTCTGGAGAGAAACCATACCGTTGTGAAGAATGTGGCAAAGCCTTCCGTAGGTCAACATACTTTCACCAACACCAAAG

AATTCATACTGGAGAGAAACCCTACCAGTGTGAAGAGTGTGGGAAAACATTCTACTATCGTTCAAACCTGAAGGGACATCAGATTATTCATTCTGGAGTG

AAACCCTACAAGTGTGAAGTATGTGGGAGCATGTTTAGAACTAGCTCAGACCTTTCTAAGCACCAGAGGATCCATGCGGAAGTGAAGCTGTACAGTTGTG

AGGAGTGCGGGAAAGCCTTTTCTACTCATTCGTACCTCATTCGGCACAAATTGGGCCACTCTAGAGAGAAACCATACAAATGCGAAGAGTGTGGCAAAAC

ATTTTGTTATCCTTCAATCCTTAAGGAACATCAACGAATTCATTCTGGAGTGAAACCTTACAATTGTGAAATATGTGGCAGCATGTTTAGAACTCGCTCC

GAACTTTCTAAGCACCAGAGAATCCATGCTGAAGTGAAGCTCTACAACTGTGAGGAGTGCGGGAAAGCCTTTTCTACTCACTCCTACCTTATGAGGCATA

GACTTGGTCACTCTGGAGAGAAGCCCTACAAATGTGAAGAGTGTGGGAAATCCTATAGCTACCCTTCACTCCTTAAGGAACATCAAAGAATTCATTCTCA

GAATCCCTATAAGTGTGACGTGTGTGGGAAGGTTTTTTGTACTCGCTCAGGACGTTCTAAACACCAGAGAATTCACACCGGAGAGAAACCTTACAAGTGT

GAAGACTGTGGGAAGGGATTCTCGACTCACTCATACCTTACTCTGCACAAATTACTTCATACCGGAGAGAAACCTTTCAAATGGGAAGAATGTGGTGAGG

TTTTCTATACCTGCTGAAGACTTACTAAACATCAGGAAATTCACATTGGCGAAAACCCTACAAAGGTAAAGAATGTGTCAAAACTCTTTACTGTACTTCA

GACTTTAAATAATACCATAAAAACTCATACTGAAGAGAAACCATACTTTAATTAGGGCTTCGTTAGATACAAGGTACGTCCTACTGTAGAGAAACTTTAC

AGATGTGGAGAATGTGGACAAATATTTTACCGTACTTCACAACTTTAACAGCCAGCAAAAGGGCTCATTCTCAGAAGAATCCCTTCAAGTGTGAAGTATG

GGACAAGGTATTATGTGCTACCTTGAGCTTTCTGTCTACCAGAACATGTATCCTGGAGAGAAACTCTGCAAGTGTGAAAAATTTGGAAAGTTTTTTAACT

CATTCCTCCCTGATTCTGATCAGACTTGGCAAAGTTTGGGGCGGGCGTTGTGTTTTTGTTTTAGGATAATTGTGCTCAGGCCTGTTGATTGTGGGAGGAA

CCAACCCATCTCTGTTGAGCAAGGATCCTGGATTGTATAAAAGGAGAAAGGGAACTGAGAAGAAGCGCTCCTCTCTCTTCCTCTGCCCTCTGACTGTCGA

GGCAATAGGAACTTCTCTTTCAGCTCCCGCTGCCCTAAAATGTCTCACGACGTTCACAGGGTCGTGATTCGAATGAGAAATGTTAACCCTGTAGTCTTAA

GCATTTGAACATTTGTGCCCCGAGTTGTTGGCTCTATTTGGAGAGATTTAGAAGTAGGTCACTAGAGGTGAACTTTGTGAATAAAGAGCTCCCTCTACAT

CCAGTTCTCTCACTCTGCTTCCTGAGTACCATTGAGGATGTGAACTCTCAGCTTCCGGCTTCGGCCACCATGCAGCTTATTCCCATGCCCACCCTCTGTC

GTGAACTTCGATCCCTTCTGTACCGCAAACTGAAGTAAAGTCATTCCTCCAT
Translation
ME - UNI21574 - EMLSFRDVAIDFSAEEWECLEPAQWNLYRDVMLENYSHLVFLG GLASCKPYLVTFLEQRQEPSVVKRPAAATVHPG - UNI8

822 - GGKPYKCQEFDKTFDWNSLLLQRQRVHPVEKPYKCEECGKVFSAHSALSIHQRIHTGEKPYKCEECGKAFSTRSALYIHKKIHSGDKPYKCEEC

AKAFYFPSLLKQHQRTHSAENLCKCEECGKAFYLPSFLKQHQRIHSAENPYRCEECGKAFSYPSTLKQHQRIHSGEKPYRCEECGKAFRRSTYFHQHQRI

HTGEKPYQCEECGKTFYYRSNLKGHQIIHSGVKPYKCEVCGSMFRTSSDLSKHQRIHAEVKLYSCEECGKAFSTHSYLIRHKLGHSREKPYKCEECGKTF

CYPSILKEHQRIHSGVKPYNCEICGSMFRTRSELSKHQRIHAEVKLYNCEECGKAFSTHSYLMRHRLGHSGEKPYKCEECGKSYSYPSLLKEHQRIHSQN

PYKCDVCGKVFCTRSGRSKHQRIHTGEKPYKCEDCGKGFSTHSYLTLHKLLHTGEKPFKWEECGEVFYTC

For any suggestions or comments, please send an email to unitrap@crg.es