Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071290 (AC112146.3-202)
Chromosomal location
Chr 12: 71255129 - 71284334 (+)
Description
not available
Human Ortholog
ENSG00000131969 (C14orf29)
Omim not available
UniTrap UNI32517
Vector Insertion
Chr 12: 71255253 - 71260328
Public Clones IST14959H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38697
Vector Insertion
Chr 12: 71270765 - 71274348
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095662
Sequence
AGCTCCCTCAGCAGTGGAGGCACCTCAGGATGGACGCTAGGGACTGTGATGCAGCCTCGGAGCCAGGGCCCCCTCCCTGTTCCTCTGTGACCTCCTGGTG

GGCTATGGTCCTGAGGAACCTGAG - UNI32517 - GCTTTTCCCATGCTTCTGCTCAGCGCTCGGGAGTAAAATAGCTGCCGAGTACAGAAACTTCA

CGAGTAAATCTTTAAAGGAACACATTTTCCCTCCGCTGATGAATATGCTGATATATTTAAATTGCA TTACGGCTCCCATTCTCGTGGATTTAAAGAGAC

CAGAGACAAAGATTGCTCACACAGTGAACTTCTTCCTCAAGCCTGAACCCAAGGTTCTGCTTGGCATCTG GCACACAGTCCCCAGCTACCGGGGAGAAG

AGGCCAAGGGGAAGTGTCGATGCTGGTACGAAGCCTCCCTCAGTGATGGGAACCCGATTATTATCTATCTTCATGGCAGTGGGATAAACAG GGCATTTT

GTGGAAGAATTAAGCTGACACAG GTGCTGAGTGATGGCGGCTTCCATGTATTGTCTGTGGACTATAGAG GATTTGGAGATTCTACAGGAACAACTACA

GAGGAGGGACTAACCACAGACATTATTTGTGTCTATGAATGGACCAAGGCAAGAAGTGGTAGAACTCCTGTGTGTCTGTGGGGCCATTCTCTGGGAACAG

G AGTTGCAACAAATGCTGCAAGAGTCCTAGAAGCAAAAG GATGTCCAGTTGATGCTATTATCTTAGAAGCTCCATTTACCAACATATGGGCAGCAACT

ATCAATTTTCCCTTGGTAAAG ATGTACTGGAAGCTTCCAGGATGTTTAAGAACGTTTGTGGATGCCCTTAAAGAAGAGAAAATAGTCTTTCCTAACGAT

GAAAA TGTGAAGTTTCTGTCCTCCCCGCTTCTCATCTTGCATGGTGAAGACGACAGGACGGTGCCTCTGGAGTTCGGAAAGCAG CTCTATGAAATTGC

ACGCAGTGCCTACAGGAACAAAGAGAGGGTCAAAATGGTCGTCTTTCCTCCTGGCTTCCATCACGACTATCTCTTTAAGAGCCCCATGCTGTTAAGTACT

GTGAG AGACTTCCTGAGCGAGCAGTGGGCATAAAAGGCTGGGACCAGCAGAAATTTCCAGTGAAGATGTGGTTCAAACCTTGCCTGAGCTGGGTGGTTT

CTTTATGCAAAATTGTGCTGGGATGCTTGGATGAGCTGAAGCTCACCCGACATTTGAATAAACAAAGCTGCATGG
Translation
MDARDCDAASEPGPPPCSSVTSWWAMVLRNLR - UNI32517 - RLFPCFCSALGSKIAAEYRNFTSKSLKEHIFPPLMNMLIYLNCI ITAPILVDL

KRPETKIAHTVNFFLKPEPKVLLGIW WHTVPSYRGEEAKGKCRCWYEASLSDGNPIIIYLHGSGINR RAFCGRIKLTQ VLSDGGFHVLSVDYRG GF

GDSTGTTTEEGLTTDIICVYEWTKARSGRTPVCLWGHSLGTG GVATNAARVLEAKG GCPVDAIILEAPFTNIWAATINFPLVK MYWKLPGCLRTFVD

ALKEEKIVFPNDEN NVKFLSSPLLILHGEDDRTVPLEFGKQ LYEIARSAYRNKERVKMVVFPPGFHHDYLFKSPMLLSTVR RDFLSEQWA

For any suggestions or comments, please send an email to unitrap@crg.es