Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071369 (Map3k5)
Chromosomal location
Chr 10: 19654278 - 19861529 (+)
Description
mitogen-activated protein kinase kinase kinase 5 Gene [Source:MGI (curated);Acc:Map3k5-001]
RefSeq_dna
NM_008580 
RefSeq_peptide
NP_032606.4 
UniGene
Mm.6595 
MGI
MGI:1346876 
Uniprot/SWISSPROT
O35099 
Uniprot/SPTREMBL
Q14AY4 Q8CC79 Q14AY5 
Human Ortholog
ENSG00000197442 (MAP3K5)
Omim not available
UniTrap UNI33835
Vector Insertion
Chr 10: 19749010 - 19766177
Public Clones IST14246H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120259
Sequence
GCCCGGAGCTGTGGCTAGCCAGACGGTGCGTCTGGGCTGGGGACTCCGGGGTCGCCGCCGTGGCAGCCCGGCAGGCAGAGATGGGCACCGAAGCCGGCGA

GGGCATCACTTTCTCCGTGCCGCCCTTTGCGTCCGTGGGCTTTTGCACCATCCCGGAGGGCGGCAGCTGCCGGAGGGGAGGAGGAGCGGCGACGGCGGCG

GAGGGAGAGCCGAGCCTGCAGCCCTTGCTTGTGCCGCCGCCGCCGCCACCGCCGGGCAGTTTCTGGAACGTGGAGAGCGCGGCGGCTCCCGGCACCAGCT

GCCCTACCACCGCCCCCGGGAGCAGCGCCACCCGAGGCCGGGGCAACTCTGGCAGCGGGGGCGGCCGGCGTACCACCGTGGCTTATGTGATCAATGAGGC

GAGCCAGGGGCAGCTGGTGGTGGCGGAGAGCGAGGCCCTGCAGAGCCTGCGGGAGGCGTGCGAGGCGGTGGGCGCCACCCTGGAGACCCTGCATTTCGGG

AAGCTGGACTTCGGGGAAACCGCCGTGCTGGACCGTTTTTACAACGCAG ATATTGCTGTGGTGGAGATGAGCGACGCCTTCCGGCAGCCTTCCTTGTTT

TACCATCTTGGAGTGCGAGAAAGCTTCAGTATGGCCAACAACATCATCCTCTACTGCGATACTAATTCCGATTCACTCCAGTCCCTGAAG GTGTGCACC

GGGAACTACACCTTCATCCCCTACATGGTGACACCACACAACAAGGTCTACTGCTGTGACAGCAGCTTCATGAAGGGCCTGACTGAGCTCATGCAGCCTA

ACTTCGAGCTCCTGCTGGGGCCCATCTGCTTACCCCTCGTGGACCGTTTCGTTCAGCTTTTGAAGGTGGCGCAAGCGAGTTCCAG CCAGTACTTCCGGG

AATCCATACTCAGCGATATCAGGAAAGCACGGAACCTGTACACTGGTAAAGAATTGGCAGCTGAATTGGCGAGGATCCGGCAACGGGTAGACAATATTGA

AGTTTTGACAGCAGACATTGTTATCAACCTGTTGCTTTCCTACAGAGACATCCAG GACTATGACTCCATAGTGAAGCTGGTAGAGACGTTAGAAAAACT

TCCAACCTTCGACTTGGCCTCGCACCACCACGTGAAGTTTCATTACGCATTTGCACTGAACAG GAGAAATCTCCCTGGAGACAGAGCAAAAGCTCTTGA

CATCATGATCCCCATGGTACAAAGTGAAGAGCAAGTTGCTTCGGATATGTATTGTCTCGTTGGCCGAATCTACAAAGATATGTTTTTGGATTCAAATTTC

ACTGACACGGAAAGCAGGGACCATGGAGCATCTTG - UNI33835 - GTTCAAAAAGGCATTTGAGTCTGAGCCAACACTACAGTCAGGAATTAATTA

TGCAGTTCTCTTGCTGGCGGCTGGGCACCAGTTTGAATCTTCTTTTGAGCTTCGGAAAGTTG GAGTGAAGCTGAGTAGCCTTCTGGGTAAAAAGGGGAA

CTTGGAAAAACTCCAGAGCTACTGGGAAGTCGGATTTTTTCTGGGAGCCAGTGTCCTGGCCAACGACCACCTCAGGGTCATTCAGGCATCCGAGAAGCTG

TTCAGACTGAAGACACCAGCGTG GTACCTCAAGTCTATCGTGGAGACCATTCTGATATATAAACACTTTGTGAAACTGACCACAGAGCAGCCCTCGGCT

AAGCAGGAACTCGTGGACTTCTGGATGGATTTCCTGGTCGAGGCCACAAAAACAGATGTTACTGTTGTCAGGTTCCCA GTATTAATATTAGAGCCAACC

AAAATCTATCAGCCTTCTTACCTGTCTATCAATAATGAAGTTGAGGAGAAGACAATATCTATTTGGCATGTTCTCCCTGATGACAAG AAAGGTATACAC

GAGTGGAACTTCGGTGCTTCCTCTGTCAGGGGAGTGAG CATCTCTAAGTTTGAAGAACGATGCTGTTTCCTTTATGTGCTTCACAATTCTGATGACTTC

CAAATCTACTTCTGCACAGAACTTCACTGTAAAAG GTTTTTTGAAATGGTGAATACCATCACGGAAGAGAAGGGGAGAGGCGCGGAGGACGGAGACTGT

GAGGGTGACTCCCTGGAG TATGACTACGAATACGATGAAAATGGAGACAGAGTTGTGTTAGGGAAGGGCACTTATGGGATCGTCTATGCAGGACGAGAC

CTGAGCAACCAGGTCAGAATTGCTATTAAGGAAATCCCAGAGAGAGACAGCAG ATACTCTCAGCCCCTGCATGAAGAAATCGCCCTGCACAAGCATCTG

AAACACAAAAACATTGTCCAGTATCTGGGCTCCTTCAGTGAGAACGGCTTCATCAAAATCTTCATGGAGCAAGTCCCAGGAG GAAGCCTCTCTGCTCTC

CTTCGTTCAAAATGGGGCCCATTAAAGGACAACGAACAGACGATTGGCTTCTATACGAAGCAGATACTGGAAGGATTAAAATACCTTCACGACAATCAGA

TAGTCCACCGGGATATAAAG GGTGACAATGTATTGATTAATACCTACAGTGGTGTGCTCAAGATCTCTGACTTCGGGACATCCAAGAGGCTTGCTGGCA

TAAACCCATGTACCGAAACCTTTACAG GTACCCTTCAGTATATGGCGCCAGAAATAATCGATAAAGGACCACGAGGCTATGGAAAGGCCGCCGACATTT

GGTCACTGGGCTGCACAATCATCGAAATGGCTACTGGAAAACCACCATTTTATGAACTAGGAGAGCCACAGGCAGCCATGTTCAAG GTGGGGATGTTTA

AGGTCCACCCGGAGATCCCAGAGTCCATGTCGGCGGAGGCCAAGGCGTTCATACTGAAGTGTTTTGAACCAGACCCTGACAAGAGAGCCTGTGCTAATGA

CTTGCTTATTGATGAGTTCTTAAAAGTGTCCAGCAAAAAGAAAAAGACACAACCCAAACTTTCAG CTCTCTCGACTGGATCGAATG AGTATCTTAGAA

GCATCTCCCTGCCGGTCCCTGTCCTGGTAGAAGACACCAGCAGCAGTAGCGAGTATGGCTCTGTTTCTCCTGATACAGAGCTGAAGGCGGACCCCTTCTC

CTTCAAAGCCAGAGCTAAGTCCTGTGGAGAAAAGGACGGGAAAGGGATACGGACATTGTTCCTGGG CATTCCAGATGAAAATTTTGAAGATCACAGTGC

GCCCCCATCTCCTGAAGAGAAAGACTCGGGCTTTTTTATGCTGAGAAAGGATAGTGAGAGGCGAGCTACCCTTCACAGAATCCTGACCGAAGACCAGGAC

AAGGTTGTAAGGAACCTAATGGAATCTCTGGCCCAG GGTGCTGAAGAGCCTAAACTAAAGTGGGAACACATCACAACCCTCATCTCGAGCCTCAGAGAG

TTTGTGAGGTCCACTGACCGAAAAATCATAGCCACTACACTGTCCAAGCTCAAGCTGGAGCTGGACTTCGACAGCCACGGCATCAGCCAGGTGCAGGTGG

TCCTCTTTGGCTTCCAGGATGCG GTCAATAAAGTTCTTCGGAATCATAACATCAAGCCACACTGGATGTTTGCCCTGGACAGCATCATCCGAAAGGCTG

TGCAGACTGCAATTACCATTCTGGTTCCAG AGTTGAGGCCACATTTTAGCCTTGCATCAGAGAGCGACACAGCTGATCCGGAAGACCTGGATGTCGAAG

ATGAACACGAGGAATTGTCTTCAAATCAGACAGTCCGACGGCCTCAGGCCATCACTGAGGACGCTGTGGCTACCTCGGGGGTGAGCACGCTAAGCTCCAC

TGTGTCCCATGACTCCCAGAATGCACACCGGTCGCTGAACGTGCAGCTTGGAAGGATGAAGATTGAAACTAATAG GTTACTTGAAGAGCTGGTTCGGAA

AGAGAGAGAGTTACAGGCACTCCTCCATCAAGCCATTGAGGAAAAAGACCAAGAAATTAGGCACCTGAAGCTCAAGTCCCAGCCCATAG ATATCCCTGG

GTTTCCTGTGTGCCACCTGAACTCTCCTGGCACGACCACGGAAGATTCTGAACTTCCTGGCTGGCTGAGAGAAAATGGAGCTGATGAAGACACTATAAGT

CGG TTTCTGGCTGAGGATTACACGCTAGTGGATGTTCTTTACTACGTCACACGTGATGATCTGAAGTGCCTCAGACTAAG GGGCGGGATGCTGTGCAC

GCTGTGGAAGGCCATCATTGACTTTCGGAACAAATGCTGACCGCCACCAGGGTGACCTTGACTGGAGAGCCTGAACTTTGAAGTAGAATGCTCTCCTGTG

GGAGGGGGAGCCGACAGGAGGAGAGGGAGA
Translation
MGTEAGEGITFSVPPFASVGFCTIPEGGSCRRGGGAATAAEGEPSLQPLLVPPPPPPPGSFWNVESAAAPGTSCPTTAPGSSATRGRGNSGSGGGRRTTV

AYVINEASQGQLVVAESEALQSLREACEAVGATLETLHFGKLDFGETAVLDRFYNAD DIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDS

LQSLK VCTGNYTFIPYMVTPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFVQLLKVAQASSS SQYFRESILSDIRKARNLYTGKELAAEL

ARIRQRVDNIEVLTADIVINLLLSYRDIQ DYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNR RRNLPGDRAKALDIMIPMVQSEEQVASDMYCLV

GRIYKDMFLDSNFTDTESRDHGASW - UNI33835 - WFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVG GVKLSSLLGKKGNLEKLQSYW

EVGFFLGASVLANDHLRVIQASEKLFRLKTPAW WYLKSIVETILIYKHFVKLTTEQPSAKQELVDFWMDFLVEATKTDVTVVRFP VLILEPTKIYQPS

YLSINNEVEEKTISIWHVLPDDK KGIHEWNFGASSVRGVS SISKFEERCCFLYVLHNSDDFQIYFCTELHCKR RFFEMVNTITEEKGRGAEDGDCEG

DSLE YDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSR RYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGG GSLS

ALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIK GDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTG GTLQYMAPEIIDKGPRGYGK

AADIWSLGCTIIEMATGKPPFYELGEPQAAMFK VGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVSSKKKKTQPKLSA ALSTG

SNE EYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKADPFSFKARAKSCGEKDGKGIRTLFLG GIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRAT

LHRILTEDQDKVVRNLMESLAQ GAEEPKLKWEHITTLISSLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDA VNKVLRNHNIKPHW

MFALDSIIRKAVQTAITILVPE ELRPHFSLASESDTADPEDLDVEDEHEELSSNQTVRRPQAITEDAVATSGVSTLSSTVSHDSQNAHRSLNVQLGRMK

IETNR RLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPID DIPGFPVCHLNSPGTTTEDSELPGWLRENGADEDTISR FLAEDYTLVDVLYYV

TRDDLKCLRLR RGGMLCTLWKAIIDFRNKC
Transcript ENSMUST00000095806
Sequence
GCGGTGAAGGCGCGGCGCGCGATGGCAGCTGCCTAGCCCGGCGCGCGCGGAGCAGCCCGGAGCTGTGGCTAGCCAGACGGTGCGTCTGGGCTGGGGACTC

CGGGGTCGCCGCCGTGGCAGCCCGGCAGGCAGAGATGGGCACCGAAGCCGGCGAGGGCATCACTTTCTCCGTGCCGCCCTTTGCGTCCGTGGGCTTTTGC

ACCATCCCGGAGGGCGGCAGCTGCCGGAGGGGAGGAGGAGCGGCGACGGCGGCGGAGGGAGAGCCGAGCCTGCAGCCCTTGCTTGTGCCGCCGCCGCCGC

CACCGCCGGGCAGTTTCTGGAACGTGGAGAGCGCGGCGGCTCCCGGCACCAGCTGCCCTACCACCGCCCCCGGGAGCAGCGCCACCCGAGGCCGGGGCAA

CTCTGGCAGCGGGGGCGGCCGGCGTACCACCGTGGCTTATGTGATCAATGAGGCGAGCCAGGGGCAGCTGGTGGTGGCGGAGAGCGAGGCCCTGCAGAGC

CTGCGGGAGGCGTGCGAGGCGGTGGGCGCCACCCTGGAGACCCTGCATTTCGGGAAGCTGGACTTCGGGGAAACCGCCGTGCTGGACCGTTTTTACAACG

CAG ATATTGCTGTGGTGGAGATGAGCGACGCCTTCCGGCAGCCTTCCTTGTTTTACCATCTTGGAGTGCGAGAAAGCTTCAGTATGGCCAACAACATCA

TCCTCTACTGCGATACTAATTCCGATTCACTCCAGTCCCTGAAG GAAATTATTTGCCAGAAGAATACT GTGTGCACCGGGAACTACACCTTCATCCCC

TACATGGTGACACCACACAACAAGGTCTACTGCTGTGACAGCAGCTTCATGAAGGGCCTGACTGAGCTCATGCAGCCTAACTTCGAGCTCCTGCTGGGGC

CCATCTGCTTACCCCTCGTGGACCGTTTCGTTCAGCTTTTGAAGGTGGCGCAAGCGAGTTCCAG CCAGTACTTCCGGGAATCCATACTCAGCGATATCA

GGAAAGCACGGAACCTGTACACTGGTAAAGAATTGGCAGCTGAATTGGCGAGGATCCGGCAACGGGTAGACAATATTGAAGTTTTGACAGCAGACATTGT

TATCAACCTGTTGCTTTCCTACAGAGACATCCAG GACTATGACTCCATAGTGAAGCTGGTAGAGACGTTAGAAAAACTTCCAACCTTCGACTTGGCCTC

GCACCACCACGTGAAGTTTCATTACGCATTTGCACTGAACAG GAGAAATCTCCCTGGAGACAGAGCAAAAGCTCTTGACATCATGATCCCCATGGTACA

AAGTGAAGAGCAAGTTGCTTCGGATATGTATTGTCTCGTTGGCCGAATCTACAAAGATATGTTTTTGGATTCAAATTTCACTGACACGGAAAGCAGGGAC

CATGGAGCATCTTG - UNI33835 - GTTCAAAAAGGCATTTGAGTCTGAGCCAACACTACAGTCAGGAATTAATTATGCAGTTCTCTTGCTGGCGGC

TGGGCACCAGTTTGAATCTTCTTTTGAGCTTCGGAAAGTTG GAGTGAAGCTGAGTAGCCTTCTGGGTAAAAAGGGGAACTTGGAAAAACTCCAGAGCTA

CTGGGAAGTCGGATTTTTTCTGGGAGCCAGTGTCCTGGCCAACGACCACCTCAGGGTCATTCAGGCATCCGAGAAGCTGTTCAGACTGAAGACACCAGCG

TG GTACCTCAAGTCTATCGTGGAGACCATTCTGATATATAAACACTTTGTGAAACTGACCACAGAGCAGCCCTCGGCTAAGCAGGAACTCGTGGACTTC

TGGATGGATTTCCTGGTCGAGGCCACAAAAACAGATGTTACTGTTGTCAGGTTCCCA GTATTAATATTAGAGCCAACCAAAATCTATCAGCCTTCTTAC

CTGTCTATCAATAATGAAGTTGAGGAGAAGACAATATCTATTTGGCATGTTCTCCCTGATGACAAG AAAGGTATACACGAGTGGAACTTCGGTGCTTCC

TCTGTCAGGGGAGTGAG CATCTCTAAGTTTGAAGAACGATGCTGTTTCCTTTATGTGCTTCACAATTCTGATGACTTCCAAATCTACTTCTGCACAGAA

CTTCACTGTAAAAG GTTTTTTGAAATGGTGAATACCATCACGGAAGAGAAGGGGAGAGGCGCGGAGGACGGAGACTGTGAGGGTGACTCCCTGGAG TA

TGACTACGAATACGATGAAAATGGAGACAGAGTTGTGTTAGGGAAGGGCACTTATGGGATCGTCTATGCAGGACGAGACCTGAGCAACCAGGTCAGAATT

GCTATTAAGGAAATCCCAGAGAGAGACAGCAG ATACTCTCAGCCCCTGCATGAAGAAATCGCCCTGCACAAGCATCTGAAACACAAAAACATTGTCCAG

TATCTGGGCTCCTTCAGTGAGAACGGCTTCATCAAAATCTTCATGGAGCAAGTCCCAGGAG GAAGCCTCTCTGCTCTCCTTCGTTCAAAATGGGGCCCA

TTAAAGGACAACGAACAGACGATTGGCTTCTATACGAAGCAGATACTGGAAGGATTAAAATACCTTCACGACAATCAGATAGTCCACCGGGATATAAAG 

GGTGACAATGTATTGATTAATACCTACAGTGGTGTGCTCAAGATCTCTGACTTCGGGACATCCAAGAGGCTTGCTGGCATAAACCCATGTACCGAAACCT

TTACAG GTACCCTTCAGTATATGGCGCCAGAAATAATCGATAAAGGACCACGAGGCTATGGAAAGGCCGCCGACATTTGGTCACTGGGCTGCACAATCA

TCGAAATGGCTACTGGAAAACCACCATTTTATGAACTAGGAGAGCCACAGGCAGCCATGTTCAAG GTGGGGATGTTTAAGGTCCACCCGGAGATCCCAG

AGTCCATGTCGGCGGAGGCCAAGGCGTTCATACTGAAGTGTTTTGAACCAGACCCTGACAAGAGAGCCTGTGCTAATGACTTGCTTATTGATGAGTTCTT

AAAAGTGTCCAGCAAAAAGAAAAAGACACAACCCAAACTTTCAG CTCTCTCGACTGGATCGAATG AGTATCTTAGAAGCATCTCCCTGCCGGTCCCTG

TCCTGGTAGAAGACACCAGCAGCAGTAGCGAGTATGGCTCTGTTTCTCCTGATACAGAGCTGAAGGCGGACCCCTTCTCCTTCAAAGCCAGAGCTAAGTC

CTGTGGAGAAAAGGACGGGAAAGGGATACGGACATTGTTCCTGGG CATTCCAGATGAAAATTTTGAAGATCACAGTGCGCCCCCATCTCCTGAAGAGAA

AGACTCGGGCTTTTTTATGCTGAGAAAGGATAGTGAGAGGCGAGCTACCCTTCACAGAATCCTGACCGAAGACCAGGACAAGGTTGTAAGGAACCTAATG

GAATCTCTGGCCCAG GGTGCTGAAGAGCCTAAACTAAAGTGGGAACACATCACAACCCTCATCTCGAGCCTCAGAGAGTTTGTGAGGTCCACTGACCGA

AAAATCATAGCCACTACACTGTCCAAGCTCAAGCTGGAGCTGGACTTCGACAGCCACGGCATCAGCCAGGTGCAGGTGGTCCTCTTTGGCTTCCAGGATG

CG GTCAATAAAGTTCTTCGGAATCATAACATCAAGCCACACTGGATGTTTGCCCTGGACAGCATCATCCGAAAGGCTGTGCAGACTGCAATTACCATTC

TGGTTCCAG AGTTGAGGCCACATTTTAGCCTTGCATCAGAGAGCGACACAGCTGATCCGGAAGACCTGGATGTCGAAGATGAACACGAGGAATTGTCTT

CAAATCAGACAGTCCGACGGCCTCAGGCCATCACTGAGGACGCTGTGGCTACCTCGGGGGTGAGCACGCTAAGCTCCACTGTGTCCCATGACTCCCAGAA

TGCACACCGGTCGCTGAACGTGCAGCTTGGAAGGATGAAGATTGAAACTAATAG GTTACTTGAAGAGCTGGTTCGGAAAGAGAGAGAGTTACAGGCACT

CCTCCATCAAGCCATTGAGGAAAAAGACCAAGAAATTAGGCACCTGAAGCTCAAGTCCCAGCCCATAG ATATCCCTGGGTTTCCTGTGTGCCACCTGAA

CTCTCCTGGCACGACCACGGAAGATTCTGAACTTCCTGGCTGGCTGAGAGAAAATGGAGCTGATGAAGACACTATAAGTCGG TTTCTGGCTGAGGATTA

CACGCTAGTGGATGTTCTTTACTACGTCACACGTGATGATCTGAAGTGCCTCAGACTAAG GGGCGGGATGCTGTGCACGCTGTGGAAGGCCATCATTGA

CTTTCGGAACAAATGCTGACCGCCACCAGGGTGACCTTGACTGGAGAGCCTGAACTTTGAAGTAGAATGCTCTCCTGTGGGAGGGGGAGCCGACAGGAGG

AGAGGGAGAAGCTGCACTTTAAATCCAGTCTTTGTTTACTCGTGTCGCAAAGAAAGAAAGAA
Translation
MGTEAGEGITFSVPPFASVGFCTIPEGGSCRRGGGAATAAEGEPSLQPLLVPPPPPPPGSFWNVESAAAPGTSCPTTAPGSSATRGRGNSGSGGGRRTTV

AYVINEASQGQLVVAESEALQSLREACEAVGATLETLHFGKLDFGETAVLDRFYNAD DIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDS

LQSLK EIICQKNT VCTGNYTFIPYMVTPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFVQLLKVAQASSS SQYFRESILSDIRKARNLY

TGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQ DYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNR RRNLPGDRAKALDIMIPMVQSEEQ

VASDMYCLVGRIYKDMFLDSNFTDTESRDHGASW - UNI33835 - WFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVG GVKLSSLLGKKG

NLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAW WYLKSIVETILIYKHFVKLTTEQPSAKQELVDFWMDFLVEATKTDVTVVRFP VLIL

EPTKIYQPSYLSINNEVEEKTISIWHVLPDDK KGIHEWNFGASSVRGVS SISKFEERCCFLYVLHNSDDFQIYFCTELHCKR RFFEMVNTITEEKGR

GAEDGDCEGDSLE YDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSR RYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQ

VPGG GSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIK GDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTG GTLQYMAPEII

DKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFK VGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVSSKKKKTQPK

LSA ALSTGSNE EYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKADPFSFKARAKSCGEKDGKGIRTLFLG GIPDENFEDHSAPPSPEEKDSGFFML

RKDSERRATLHRILTEDQDKVVRNLMESLAQ GAEEPKLKWEHITTLISSLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDA VNKVL

RNHNIKPHWMFALDSIIRKAVQTAITILVPE ELRPHFSLASESDTADPEDLDVEDEHEELSSNQTVRRPQAITEDAVATSGVSTLSSTVSHDSQNAHRS

LNVQLGRMKIETNR RLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPID DIPGFPVCHLNSPGTTTEDSELPGWLRENGADEDTISR FLAEDY

TLVDVLYYVTRDDLKCLRLR RGGMLCTLWKAIIDFRNKC

For any suggestions or comments, please send an email to unitrap@crg.es