Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071533 (Pcnp)
Chromosomal location
Chr 16: 56007358 - 56029830 (-)
Description
PEST proteolytic signal containing nuclear protein Gene [Source:MGI (curated);Acc:Pcnp-008]
RefSeq_dna
NM_001024622 
RefSeq_peptide
NP_001019793.1 
UniGene
Mm.310642 Mm.476181 Mm.476501 
MGI
MGI:1923552 
Uniprot/SWISSPROT
Q6P8I4 
Uniprot/SPTREMBL
Q3TM89 Q3UCC5 
Human Ortholog
ENSG00000081154 (PCNP)
Omim not available
UniTrap UNI8604
Vector Insertion
Chr 16: 56024782 - 56029715
Public Clones (sanger) XG526 (baygenomics) W223B03 (ggtc) P030B10 (ggtc) D001B10 (ggtc)
Q023C05 (ggtc) PST4393-NR (escells) PST12696-NL (escells) PST12013-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22656
Vector Insertion
Chr 16: 56024336 - 56024552
Public Clones not available
Private Clones OST288802 (lexicon) OST43334 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28317
Vector Insertion
Chr 16: 56022243 - 56024336
Public Clones (sanger) IST15056C12 (tigm)
Private Clones OST34065 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27424
Vector Insertion
Chr 16: 56018584 - 56018641
Public Clones not available
Private Clones OST59892 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34516
Vector Insertion
Chr 16: 56018584 - 56022243
Public Clones IST10087C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36938
Vector Insertion
Chr 16: 56017303 - 56018641
Public Clones 3SE056B11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28675
Vector Insertion
Chr 16: 56007596 - 56015620
Public Clones not available
Private Clones OST23929 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122253
Sequence
GGGCTGCAGGGGGAGGCCGCGGCGAGGAAGATGGCGGACGGGAAGGCGGGAGAGGAGAAGCCAGAGAAGCCGCAGCGAGCCGGAGCCGCCGGAG - UNI

8604 - - UNI22656 - GACCTGAAGAAGAAGCAGAAAAACCTGTGAAAACTAAGACTGTTTCTTCCAGTAATGGAGGGGAAAGTTCCAGTCGCAGC

GCTGAAAAGCGATCAGCTGAAGACGAAGCTGCAGACCTCCCAACAAAGCCTACAAAGATGTCCAAGTTTGGATTTGCCATAGGTAGTCAGACGGCACGGA

AAGCGTCCGCCATCTCCATTAGACTCGGAGCAAGT - UNI22656 - - UNI28317 - - UNI34516 - AAGCCTAAGGAAACAGTTCCAACTC

TTGCTCCAAAAACTCTGTCGGTAGCAGCAGCTTTCAATGAAGATGAAGAT - UNI27424 - - UNI34516 - AGTGAGCCAGAAGAAATGCCTCC

AGAAGCAAAGATGAGGATGAAGAACATTGGAAGGTGCCGTGCTTTCATAATTATCATAGAGCTGTAGGAGAAGCGAGGACAAGAATACAGTACACGTTAC

CACAAAGAATTAACATCTAAATCGATCTACAATCTCTAGGTCAATTAAATGCAGTCCCAGTGGCTCAGCCTGTCGTTACTAGAACTTGAATAAATGTCTG

ATACTATTGCCAGTTCAAATGAAGTACACACGTGCACATTTTTTTTTCATTTATTTTTGAGACAGAGTCTTACTAAGCAGCCCTGGCTGTCCTAGAGCTC

GCTATATAGACTGGATCCACCTGCCTCTGCCTCCAGAGTACTGGGATTAAAACATCGACACTGCATGTTTCTCTTTTACATATGT
Translation
MADGKAGEEKPEKPQRAGAAGG - UNI8604 - - UNI22656 - GPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEDEAADLPTKPTKMSKFGF

AIGSQTARKASAISIRLGAS - UNI22656 - - UNI28317 - - UNI34516 - KPKETVPTLAPKTLSVAAAFNEDED - UNI27424 - -

 UNI34516 - SEPEEMPPEAKMRMKNIGRCRAFIIIIEL
Transcript ENSMUST00000119981
Sequence
GGGAGCCTCTTGTACTGCCACACAATCTCAGTTCCTGCTGTACACTCTAGCAAGCAGTGAAGAGACTGTTGGGTCAGTAGGTGACAGCTGCAGAGGTATC

TTCTTGTAAAGATGCTTTTTGAGGTTGCTGCTCCCATCAATCTGCTCAGTAAAAATAGCTCATCTTGGTAAGTTGTTTCGACTTCACCAGGACCTGAAGA

AGAAGCAGAAAAACCTGTGAAAACTAAGACTGTTTCTTCCAGTAATGGAGGGGAAAGTTCCAGTCGCAGCGCTGAAAAGCGATCAGCTGAAGACGAAGCT

GCAGACCTCCCAACAAAGCCTACAAAGATGTCCAAGTTTGGATTTGCCATAGGTAGTCAGACGGCACGGAAAGCGTCCGCCATCTCCATTAGACTCGGAG

CAAGT - UNI22656 - - UNI28317 - - UNI34516 - AAGCCTAAGGAAACAGTTCCAACTCTTGCTCCAAAAACTCTGTCGGTAGCAGCAG

CTTTCAATGAAGATGAAGAT - UNI27424 - - UNI34516 - AGTGAGCCAGAAGAAATGCCTCCAGAAGCAAAGATGAGGATGAAGAACATTGG

AAG - UNI27424 - - UNI34516 - GGACACACCAACATCAGCGGGACCAAACTCCTTTAATAAAGGGAAGCATGGCTTTTCCGATAACCAGAAG

CTGTGGGAGCGAAATATAAAATCTCATCTTGGAAACGTCCACGACCAAGACAATTAA - UNI28675 - AAAGAGGACTTTCTGCAGAACTCACTGGC

CAGACAAGAAGACTAGTGATGTCACCAACAACCCAGAGTTCCACAACCCAGGACTGCATAGTGGTGACATAAACTGTAAACGCGTCCTCGGTGAGCTCCT

CGGGCAGGCTTGCCCGTGACAGCAGCACTCACTCTGCCTCTGGCATATGTGCAACCTCCACTTCAACAGTCTGAATGGCTTCTGCAACTTCAGACAGCTT

CTGCCCTTG
Translation
MSKFGFAIGSQTARKASAISIRLGAS - UNI22656 - - UNI28317 - - UNI34516 - KPKETVPTLAPKTLSVAAAFNEDED - UNI274

24 - - UNI34516 - SEPEEMPPEAKMRMKNIGR - UNI27424 - - UNI34516 - RDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGN

VHDQDN - UNI28675 - 
Transcript ENSMUST00000096021
Sequence
TAATTTTAAATTGCTCTGTATTTTATGCTAGTTAATTCATGGGAGCCTCTTGTACTGCCACACAATCTCAGTTCCTGCTGTACACTCTAGCAAGCAGTGA

AGAGACTGTTGGGTCAGTAGGTGACAGCTGCAGAG - UNI22656 - GACCTGAAGAAGAAGCAGAAAAACCTGTGAAAACTAAGACTGTTTCTTCCA

GTAATGGAGGGGAAAGTTCCAGTCGCAGCGCTGAAAAGCGATCAGCTGAAGACGAAGCTGCAGACCTCCCAACAAAGCCTACAAAGATGTCCAAGTTTGG

ATTTGCCATAGGTAGTCAGACGGCACGGAAAGCGTCCGCCATCTCCATTAGACTCGGAGCAAGT - UNI22656 - - UNI28317 - - UNI3451

6 - AAGCCTAAGGAAACAGTTCCAACTCTTGCTCCAAAAACTCTGTCGGTAGCAGCAGCTTTCAATGAAGATGAAGAT - UNI27424 - - UNI34

516 - AGTGAGCCAGAAGAAATGCCTCCAGAAGCAAAGATGAGGATGAAGAACATTGGAAG - UNI27424 - - UNI34516 - GGACACACCAA

CATCAGCGGGACCAAACTCCTTTAATAAAGGGAAGCATGGCTTTTCCGATAACCAGAAGCTGTGGGAGCGAAATATAAAATCTCATCTTGGAAACGTCCA

CGACCAAGACAATTAA
Translation
MGASCTATQSQFLLYTLASSEETVGSVGDSCRG - UNI22656 - GPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEDEAADLPTKPTKMSKFGFA

IGSQTARKASAISIRLGAS - UNI22656 - - UNI28317 - - UNI34516 - KPKETVPTLAPKTLSVAAAFNEDED - UNI27424 - - 

UNI34516 - SEPEEMPPEAKMRMKNIGR - UNI27424 - - UNI34516 - RDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN
Transcript ENSMUST00000114444
Sequence
GGGGCCGTGACGTTCTTGCCCGGGCTGCAGGGGGAGGCCGCGGCGAGGAAGATGGCGGACGGGAAGGCGGGAGAGGAGAAGCCAGAGAAGCCGCAGCGAG

CCGGAGCCGCCGGAG - UNI8604 - - UNI22656 - GACCTGAAGAAGAAGCAGAAAAACCTGTGAAAACTAAGACTGTTTCTTCCAGTAATGGA

GGGGAAAGTTCCAGTCGCAGCGCTGAAAAGCGATCAGCTGAAGACGAAGCTGCAGACCTCCCAACAAAGCCTACAAAGATGTCCAAGTTTGGATTTGCCA

TAGGTAGTCAGACGGCACGGAAAGCGTCCGCCATCTCCATTAGACTCGGAGCAAGT - UNI22656 - - UNI28317 - - UNI34516 - AAGC

CTAAGGAAACAGTTCCAACTCTTGCTCCAAAAACTCTGTCGGTAGCAGCAGCTTTCAATGAAGATGAAGAT - UNI27424 - - UNI34516 - AG

TGAGCCAGAAGAAATGCCTCCAGAAGCAAAGATGAGGATGAAGAACATTGGAAG - UNI27424 - - UNI34516 - GGACACACCAACATCAGCG

GGACCAAACTCCTTTAATAAAGGGAAGCATGGCTTTTCCGATAACCAGAAGCTGTGGGAGCGAAATATAAAATCTCATCTTGGAAACGTCCACGACCAAG

ACAATTAAGTGAAGTGTCTGAGACTGGGGTGTGGGTGGGTGCAGTTAGAAGGAGCAGTCTCCTTTTTGTAAAGAATGGTGTAAGACTAGCTTTGGAGCCG

TTTTTCTTTCTTCTTTTTTTCTTTTCCTTTTTTCTTTTTTTTTTTTTTTTTTTAAGATTGAGTGGTACACTAATAAATGAGAGTTTGCAATTAGAGGTAA

TTTATGTTTTATATACAGATTTCAAGACATTTGCTAATTTTGTAGTTTCACATGATTAGTTTCCAAGGGTTACAGATAATAAAGAAATCACAAGTGGTAC

CTTTCTAAGAATTGCATATTTTTTTAGACACAACTATTAGCACATTAAGAGGGAAGCCAAAAGTTATTGTCTGCTTCAAACTGGAAGCAGTTCCTCTCCT

GACTTCTCCCTCGTTACCCGACTGTCCGGCTCCCTGCAGCAGCCTTACCGAGAGGGAGATTGGCTTGAGAAGCCAGTGTTACTGTTGTGACTGTTGGCTG

AGAGGAAGTTTAGATGAGGTTCAAGTAAACCCTTTCCTGCGGGCATTTCGTTTTGTTTCGGGCCATTCTAGCTAGTACTGCTTCGCTCTCAGTGGGTACC

GATGCTTGCTCTGTAAAAATAAATTTTTTTCGTTAAAAATTCTTATATGAAGAATTGAGTATTATGACTAGCCCACTCTAACGGAGTGTGTCTCCGTTGA

GGACCTTCAGAGGACACTATTTGCTACCAAAGTGAACCAGTATTCTGAATGTGCTTCTCTTGGTTTCTGTTCTAGTTCCTAGAAGCATTTCCACCAGAAC

TTGAGGCAAAACATAAGGAAGCTGTTTCTTTTAAAGTACAAACACCACCAAAAATATCAGTGTACATAGTGCTTTATGTATTTGGCTGGCTTTTATTTTT

TAAAAGGTTTAAATAACAAAAAAGGAAAAAAAGGTATAGCATTGTATGAAGGCAGATGAGGCGACACACCTGTGACATTTGAAGCATTTGTGTTACTAAC

TTACTAGATCCGGTTTGAATTGAATTCACAAGGTTTCTTACTTGTCCAACTCCAGGCTTATTTTACGTACATACAACCTGACCAGTGGTTTCAAAAGCAC

ATTTAGTGACTGCAATAGGACAGAAATGCTTCTCTAGACACATCTTCATTGCGAGCGTCTCATCGCATATGCTCTTAGAGTTCTGAATGTAGGATGTTTG

TTTTGTATTTTTGTATTGTATATGGGCTTTTTAAATGTGACAGTTAAATGCATCTTTAATAGTCACAGACAAAAGAGATGATAAAATGTCCTTTGAAAAT

GGCAATGTTGAGTTTGGAGGCAGCTTCGGGGAGTTTCCTGGGTGGCGATGATTCACTGGGCAGTTTTTAATGTAGTGACTTCAAGAAGCAGCCTGCGGAT

ATTCCTAACACTTGGTTCACTACAGTTTAGTTTACTTCATAAGCCCCAAGTAAAACGATGGAAATGTACATAGCACTATTAGTTCATACATGATTTAAGT

ATATCAAGATACATAAATTTAACATTTATGTCTGCAAACTGTCCATTTGTCCATTTTACTGTTTGTTGAAATAACACCTCTCCTACATATTCTTTACTTG

ACTCGAATAACAAATTAACCTGACGTCAAGATGGAGAGAGACGACTGAGCTGAATGTCTTTACTAAAATTACAATAAATTTTGTCAAACTT
Translation
MADGKAGEEKPEKPQRAGAAGG - UNI8604 - - UNI22656 - GPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEDEAADLPTKPTKMSKFGF

AIGSQTARKASAISIRLGAS - UNI22656 - - UNI28317 - - UNI34516 - KPKETVPTLAPKTLSVAAAFNEDED - UNI27424 - -

 UNI34516 - SEPEEMPPEAKMRMKNIGR - UNI27424 - - UNI34516 - RDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN


For any suggestions or comments, please send an email to unitrap@crg.es