Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071547 (Nt5dc2)
Chromosomal location
Chr 14: 31948039 - 31952307 (+)
Description
5'-nucleotidase domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:1917271]
RefSeq_dna
NM_027289 
RefSeq_peptide
NP_081565.1 
UniGene
Mm.261681 
MGI
MGI:1917271 
Uniprot/SPTREMBL
Q91X76 Q9CY30 
Human Ortholog
ENSG00000168268 (NT5DC2)
Omim not available
UniTrap UNI28202
Vector Insertion
Chr 14: 31948291 - 31948523
Public Clones not available
Private Clones OST37406 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28540
Vector Insertion
Chr 14: 31951860 - 31951966
Public Clones not available
Private Clones OST28440 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090212
Sequence
CCCAGTATGCGGATGCACTGCACCCTGAGATCTTCAATGCTGCCCGGGACATCTTGATAGAGCACTACAAG TATCCTGAGGGGATCCGGAAGTATGACT

ATGACCCCAGCTTTGCCATCCGTGGCCTGCACTACGACATTCAGAAG - UNI28202 - AGCCTTCTGATGAAAATTGACGCTTTTCACTATGTACAA

CTGGGAACGGCCTACAG GGGCCTCAAGCCTGTGCCGGACGATGAAGTGATCGACCTGTACGGCGGCACCCAGCACATCCCACTCTACCAGATGAGCGGC

TTCTATGGCAAG GGCCCATCTATCAAGCAGTTCATGGACATCTTCTCGCTCCCAGAGATGGCTCTGCTGTCCTGTGTGGTGGACTACTTTCTGGGCCAC

GGCCTGGAGTTTGACCAAGTACATCTCTACAAGGATGTGACG GATGCTATCCGCGATGTGCATGTAAAGGGCCTCATGTACCAGTGGATCGAGCAAGAC

ATGG AGAAGTACATCCTGAGAGGAGATGAGACATTTGCGGTGCTGAGCCGCCTGGTGGCCCATGGGAAACAGCTGTTCCTCATTACCAACAGTCCCTTC

AGCTTTGT GGACAAAGGTATGCGGCACATGGTAGGTCCCGATTGGCGCCAACTCTTCGACGTCGTCATCGTCCAGGCAGACAAGCCCAACTTTTTCACC

GACAGGCGCAA GCCTTTTCGCAAGCTTGACGAGAAGGGCTCCCTCCACTGGGACCGTATCACTCGCCTAGAGAAGGGCAAGATCTATCGGCAG GGAAA

CCTGTTTGATTTTCTTCGTCTGACGGAATGGCGAGGGCCGCGTGTGCTCTACTTCGGTGACCACCTTTACAGTGACCTGGCG GATCTCATGCTGCGGCA

CGGCTGGCGCACGGGAGCCATCATCCCTGAGCTGGAGCGCGAGATCCGCATCATCAACACGGAGCAGTACATGCACTCGCTGACCTGGCAGCAGGCTCTC

ACTGGGCTGCTGGAGCGCATGCAG ACCTATCAGGATGCAGAGTCACGGCAGGTGCTGGCTACCTGGATGAAGGAGCGGCAAGAACTGAG - UNI2854

0 - ATGCATCACAAAGGCCCTATTCAACGCCCAGTTCGGGAGCATCTTCCGCACCTTCCACAACCCTACCTACTTCTCCCGGCGCCTCGTGCGCTTCTC

CGACCTCTACATGGCCTCACTCAGCTGCCTGCTCAACTACCGCGTAGACTTCACCTTCTACCCGCGCCGCACACCCCTGCAGCACGAGGCACCCCTCTGG

ATGGACCAGCTGTGCACTGGCTGCATGAAGACACCCTTTCTTGGTGACATGGCCCACATCCGCTGAGGGCACTTTTATTGTCCTGGACAGACCATTGGCC

CCCTCAGCCACCCTGACAAGCAATAAAAATGGTCTGTGTCTTCTC
Translation
  - UNI28202 - MKIDAFHYVQLGTAYR RGLKPVPDDEVIDLYGGTQHIPLYQMSGFYGK GPSIKQFMDIFSLPEMALLSCVVDYFLGHGLEFDQ

VHLYKDVT DAIRDVHVKGLMYQWIEQDME EKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFV VDKGMRHMVGPDWRQLFDVVIVQADKPNFFTDR

RK KPFRKLDEKGSLHWDRITRLEKGKIYRQ GNLFDFLRLTEWRGPRVLYFGDHLYSDLA DLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQA

LTGLLERMQ TYQDAESRQVLATWMKERQELR - UNI28540 - RCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYRVDFTFYP

RRTPLQHEAPLWMDQLCTGCMKTPFLGDMAHIR

For any suggestions or comments, please send an email to unitrap@crg.es