Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071650 (Ganab)
Chromosomal location
Chr 19: 8972580 - 8991153 (+)
Description
alpha glucosidase 2 alpha neutral subunit Gene [Source:MGI Symbol;Acc:MGI:1097667]
RefSeq_dna
NM_008060 
RefSeq_peptide
NP_032086.1 
MGI
MGI:1097667 
Uniprot/SWISSPROT
Q8BHN3 
Uniprot/SPTREMBL
Q149A6 A1A4T2 Q3UE86 Q9R1N7 
Human Ortholog
ENSG00000089597 (GANAB)
Omim not available
UniTrap UNI6848
Vector Insertion
Chr 19: 8972650 - 8976753
Public Clones (sanger) NPX232 (baygenomics) PST26452-NR (escells) IST14184E6 (tigm)
IST11688A3 (tigm) IST14430A12 (tigm)
Private Clones OST404627 (lexicon) OST297970 (lexicon) OST289930 (lexicon) OST222573 (lexicon)
OST211513 (lexicon) OST144678 (lexicon) OST97884 (lexicon) OST89338 (lexicon)
OST86112 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19895
Vector Insertion
Chr 19: 8976859 - 8977011
Public Clones not available
Private Clones OST377831 (lexicon) OST196798 (lexicon) OST83823 (lexicon) OST32023 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38606
Vector Insertion
Chr 19: 8977121 - 8979424
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096247
Sequence
AGGTTCGGGTCAAGGAGCAAACCCGGTACAAGATGGCGGCAATAGCGGCAGTGGCGGCGCGTAGGAGGCG - UNI6848 - GTCTTGGTTAAGTTTGG

TGCTGGCATACTTAGGGGTCTGTCTGGGGATTACACTTGCTGTGGATAGAAGCAACTTTAAGACCTGTGATGAGAGTTCCTTTTGCAA - UNI19895 

- ACGGCAGCGAAGCATTCGGCCAGGCCTCTCTCCTTACCGTGCCTTGCTGGACACTCTGCAGCTTGGTCCTGATGCTCTTACAGTCCATCTGATCCATG

AAGTCACCAAG GTGCTGCTTGTGCTGGAGCTCCAGGGCCTTCAGAAGAACATGACTCGGATCAGGATCGATGAGCTAGAGCCCCGGCGGCCTCGATACC

GAGTGCCAGATGTTTTAGTGGCTGACCCCCCCACAGCTAG GCTTTCAGTCTCTGGCCGTGATGACAACAGTGTGGAGCTAACAGTGGCTGAGGGACCCT

ACAAAATCATTTTGACAGCACAGCCATTCCGCCTTGACCTGCTAGAAGATCGAAGCCTCCTGCTCAGTGTCAATGCCCGAGGACTTATGGCCTTTGAGCA

CCAGAGGGCCCCCAGGGTCCC GCAAGAATCAAAAGACCCAGCTGAAGGCAATGGAGCCCAGCCTGAAGCAACACCTGGGGATGGTGACAAG CCAGAGG

AGACCCAGGAAAAGGCTGAGAAGGATGAGCCAGGAGCCTGGGAGGAGACATTCAAAACACATTCTGACAGCAAGCCTTATG GCCCCACGTCTGTAGGTT

TGGACTTTTCTCTGCCAGGAATGGAACATGTGTATGGGATCCCTGAGCATGCTGACAGCCTGAGACTGAAGGTCACTGA GGGCGGTGAGCCGTACCGCC

TGTACAATTTGGATGTGTTCCAGTATGAGCTGAACAACCCCATGGCTCTATATGGGTCTGTGCCTGTGCTCCTGGCACACAGCTTTCATCGAGACCTGGG

CATCTTCTGGCTTAATGCTGCTGAGACTTGGGTTGATATATCCTCCAACACGGCTGGGAAG ACCCTGTTTGGGAAGATGCTTGATTACCTGCAGGGCTC

TGGGGAGACTCCACAGACAGACATTCGTTGGATGTCAGAGAGTGGCATTATTGATGTTTTCCTAATGCTTGGCCCTTCGGTTTTTGATGTCTTTAGGCAG

TATGCTAGTCTCACAG GGACCCAGGCATTGCCCCCACTCTTCTCCCTCGGCTATCACCAGAGTCGCTGGAACTACCGGGATGAGGCTGATGTTTTGGAA

GTGGATCAGGGTTTTGATGATCACAACATGCCTTGTGATGTCATTTGGTTGGACATTGAACATGCTGATGGCAAGCGGTACTTCACTTGGGACCCCACCC

GATTTCCTCAGCCCCTCAATATGCTTGAGCACTTGGCTTCCAAGAGGCGGAAG CTGGTGGCCATTGTGGACCCCCACATCAAGGTAGACTCTGGCTACC

GAGTTCACGAAGAATTGCGAAACCATGGGCTGTATGTTAAAACTCGGGATGGCTCTGATTACGAGGGCTGGTGCTGGCCAG GCTCAGCTAGTTACCCTG

ACTTCACTAATCCAAGGATGAGGGCCTGGTGGTCTAACATGTTCAGCTTTGACAATTATGAG GGTTCAGCTCCTAATCTTTATGTTTGGAATGACATGA

ATGAACCGTCTGTGTTCAATGGTCCTGAGGTCACCATGTTGAAGGATGCTGTGCATTATGGAGGCTGGGAGCACCGGGACATCCATAACATCTATGGCTT

ATATGTG CACATGGCGACTGCTGATGGGCTAATACAGCGCTCTGGGGGCATAGAGCGTCCCTTTGTCCTGAGTAGGGCTTTCTTCTCAGGCTCCCAGCG

CTTTG GAGCTGTGTGGACAGGGGACAACACTGCCGAATGGGATCATTTGAAGATCTCTATCCCTATGTGTCTCAGCCTGGCACTGGTGGGGCTTTCCTT

CTGTGGAG CGGATGTGGGTGGCTTCTTCAAGAACCCAGAGCCAGAGCTGCTTGTGCGCTGGTACCAAATGGGTGCCTACCAGCCGTTCTTTCGGGCTCA

TGCCCACTTGGACACTGGGCGGCGAGAGCCATGGCTGTTAGCGTCTCAATACCAAGATGCAATCCGAGATGCCTTGTTCCAGCGATATTCTTTGCTGCCC

TTCTGGTATACCCTCTTCTATCAAGCTCACAAGGAAGGGTTTCCTGTCATGAG GCCCCTCTGGGTACAGTATCCTGAGGATATGTCTACCTTCAGTATA

GAGGATCAGTTCATGCTTG GTGATGCACTCCTTATTCACCCTGTATCGGATGCTGGGGCCCACGGAGTGCAGGTCTATTTGCCTGGCCAAGAAGAA GT

GTGGTATGACATTCAGAGCTATCAGAAGCATCATGGGCCCCAGACCTTGTATCTGCCAGTAACTTTGAGCAGT ATCCCCGTGTTCCAGCGTGGCGGAAC

CATTGTGCCTCGATGGATGCGTGTGAGGCGCTCTTCAGACTGTATGAAGGACGATCCTATCACTCTCTTTGTTGCTCTCAGTCCCCAG GGTACTGCCCA

AGGAGAGCTCTTTCTAGATGATGGACACACCTTTAACTATCAGACTCGCCATGAGTTCCTGTTGCGGCGGTTCTCTTTCTCTGGCAGCACACTGGTCTCT

AG TTCAGCAGACCCCAAAGGCCACCTTGAGACACCTATTTGGATTGAGCGAGTAGTCATCATGGGGGCTGGAAAGCCAGCAGCTGTGGTGCTCCAGACC

AAAG GATCCCCTGAAAGTCGCCTGTCCTTCCAGCATGACCCTGAGACCTCAGTGCTGATATTGCGTAAACCTGGTGTCAGCGTGGCATCCGACTGGAGT

ATTCATCTTCGATAACCCAAGGAACTTGTTCTGAGTTGGGAGGAAGGGCATGATGGTATTGAGTTACCTTTTCTTTTGCCTTGGAGTTTGACCCTACCTA

GATTTCACCTTCTAATTCTACGACCCAGATTCTGTCAACATCTGGGCAAGATGACAGGGCTGTCCTAGGGCTCTGAATTCCACTTGTGACCTAGTCTTTC

CTTCTGTGTGTTACCAAGCCCTTCATACTCAGTATCCTGTTGCTGTAACTGGAGCACAGTCATTTGTGAAGACCAAGGGGCCTTGTCGTTCTTTTTCTCT

TCCTTAGGGTCCCTACCTTCTCCTTAGACCCCATCTATTCAAGCCTCTTGTTTGTTGATGCCATTTCTTGGAAGAAGATGAGGGCAGTGAACATTAGGGT

TCCTTTTCTTCTTCCCTGTTCCCTCCTATCCAAAATGCCCATCCTTTCATTCCTTCCCCTGAATGTCCCCTTCTCTGTTCCACTGATACACTGGGACCAC

CCCTTACTTGGTAAGGGACAAATGGATCAAGATTGAGGTTCCTGGAGAACGTCCTCTTCCTTCTCATCTCAACCTTGTCTTCCTGTTTCTTTCCAGAGCT

GCTGCATTTCTCCCATCTTAGAGGGAGACGCTTCCACACAATTAGGAGGGCAAGGTTATTAAACTTCTTTTGCCCCTCTGGTCCCCTTGGGACACTCAAG

ATAGAGACATGAGTTGTGGTTTCACTGAATCACGGTCACCTGTATTTATTGCTGGGAAGAAGACTGAGGGTGGGGGGAGACGATCATGTGTACCCAGGGG

TGGCTTCAAGCCCTGGTAAGCGGGTTGAGGGAGGACTCAGGAACCAGGAGAACTATTTGTGGGAATTTTTTTTACTTCCTCTGGGTTCCCAACTGTGACA

AGTTTTGATAAAAAGGAGAAACAATAAAAAACGAAACAAAACAT
Translation
MAAIAAVAARRRR - UNI6848 - RSWLSLVLAYLGVCLGITLAVDRSNFKTCDESSFCK - UNI19895 - KRQRSIRPGLSPYRALLDTLQLGP

DALTVHLIHEVTK VLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLVADPPTAR RLSVSGRDDNSVELTVAEGPYKIILTAQPFRLDLLEDRSLLL

SVNARGLMAFEHQRAPRVP PQESKDPAEGNGAQPEATPGDGDK PEETQEKAEKDEPGAWEETFKTHSDSKPYG GPTSVGLDFSLPGMEHVYGIPEHA

DSLRLKVTE EGGEPYRLYNLDVFQYELNNPMALYGSVPVLLAHSFHRDLGIFWLNAAETWVDISSNTAGK TLFGKMLDYLQGSGETPQTDIRWMSESG

IIDVFLMLGPSVFDVFRQYASLTG GTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHNMPCDVIWLDIEHADGKRYFTWDPTRFPQPLNMLEHLAS

KRRK LVAIVDPHIKVDSGYRVHEELRNHGLYVKTRDGSDYEGWCWPG GSASYPDFTNPRMRAWWSNMFSFDNYE GSAPNLYVWNDMNEPSVFNGPEV

TMLKDAVHYGGWEHRDIHNIYGLYV HMATADGLIQRSGGIERPFVLSRAFFSGSQRFG GAVWTGDNTAEWDHLKISIPMCLSLALVGLSFCGA ADVG

GFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLASQYQDAIRDALFQRYSLLPFWYTLFYQAHKEGFPVMR RPLWVQYPEDMSTFSIEDQFM

LG GDALLIHPVSDAGAHGVQVYLPGQEE VWYDIQSYQKHHGPQTLYLPVTLSS IPVFQRGGTIVPRWMRVRRSSDCMKDDPITLFVALSPQ GTAQG

ELFLDDGHTFNYQTRHEFLLRRFSFSGSTLVSS SSADPKGHLETPIWIERVVIMGAGKPAAVVLQTKG GSPESRLSFQHDPETSVLILRKPGVSVASD

WSIHLR
Transcript ENSMUST00000096246
Sequence
AGGTTCGGGTCAAGGAGCAAACCCGGTACAAGATGGCGGCAATAGCGGCAGTGGCGGCGCGTAGGAGGCG - UNI6848 - GTCTTGGTTAAGTTTGG

TGCTGGCATACTTAGGGGTCTGTCTGGGGATTACACTTGCTGTGGATAGAAGCAACTTTAAGACCTGTGATGAGAGTTCCTTTTGCAA - UNI19895 

- ACGGCAGCGAAGCATTCGGCCAGGCCTCTCTCCTTACCGTGCCTTGCTGGACACTCTGCAGCTTGGTCCTGATGCTCTTACAGTCCATCTGATCCATG

AAGTCACCAAG GTGCTGCTTGTGCTGGAGCTCCAGGGCCTTCAGAAGAACATGACTCGGATCAGGATCGATGAGCTAGAGCCCCGGCGGCCTCGATACC

GAGTGCCAGATGTTTTAGTGGCTGACCCCCCCACAGCTAG GCTTTCAGTCTCTGGCCGTGATGACAACAGTGTGGAGCTAACAGTGGCTGAGGGACCCT

ACAAAATCATTTTGACAGCACAGCCATTCCGCCTTGACCTGCTAGAAGATCGAAGCCTCCTGCTCAGTGTCAATGCCCGAGGACTTATGGCCTTTGAGCA

CCAGAGGGCCCCCAGGGTCCC TTTCTCGGATAAAGTTAGTCTCGCGCTCGGTAGCGTGTGGGATAAGATCAAGAACCTTTTCTCTAG GCAAGAATCAA

AAGACCCAGCTGAAGGCAATGGAGCCCAGCCTGAAGCAACACCTGGGGATGGTGACAAG CCAGAGGAGACCCAGGAAAAGGCTGAGAAGGATGAGCCAG

GAGCCTGGGAGGAGACATTCAAAACACATTCTGACAGCAAGCCTTATG GCCCCACGTCTGTAGGTTTGGACTTTTCTCTGCCAGGAATGGAACATGTGT

ATGGGATCCCTGAGCATGCTGACAGCCTGAGACTGAAGGTCACTGA GGGCGGTGAGCCGTACCGCCTGTACAATTTGGATGTGTTCCAGTATGAGCTGA

ACAACCCCATGGCTCTATATGGGTCTGTGCCTGTGCTCCTGGCACACAGCTTTCATCGAGACCTGGGCATCTTCTGGCTTAATGCTGCTGAGACTTGGGT

TGATATATCCTCCAACACGGCTGGGAAG ACCCTGTTTGGGAAGATGCTTGATTACCTGCAGGGCTCTGGGGAGACTCCACAGACAGACATTCGTTGGAT

GTCAGAGAGTGGCATTATTGATGTTTTCCTAATGCTTGGCCCTTCGGTTTTTGATGTCTTTAGGCAGTATGCTAGTCTCACAG GGACCCAGGCATTGCC

CCCACTCTTCTCCCTCGGCTATCACCAGAGTCGCTGGAACTACCGGGATGAGGCTGATGTTTTGGAAGTGGATCAGGGTTTTGATGATCACAACATGCCT

TGTGATGTCATTTGGTTGGACATTGAACATGCTGATGGCAAGCGGTACTTCACTTGGGACCCCACCCGATTTCCTCAGCCCCTCAATATGCTTGAGCACT

TGGCTTCCAAGAGGCGGAAG CTGGTGGCCATTGTGGACCCCCACATCAAGGTAGACTCTGGCTACCGAGTTCACGAAGAATTGCGAAACCATGGGCTGT

ATGTTAAAACTCGGGATGGCTCTGATTACGAGGGCTGGTGCTGGCCAG GCTCAGCTAGTTACCCTGACTTCACTAATCCAAGGATGAGGGCCTGGTGGT

CTAACATGTTCAGCTTTGACAATTATGAG GGTTCAGCTCCTAATCTTTATGTTTGGAATGACATGAATGAACCGTCTGTGTTCAATGGTCCTGAGGTCA

CCATGTTGAAGGATGCTGTGCATTATGGAGGCTGGGAGCACCGGGACATCCATAACATCTATGGCTTATATGTG CACATGGCGACTGCTGATGGGCTAA

TACAGCGCTCTGGGGGCATAGAGCGTCCCTTTGTCCTGAGTAGGGCTTTCTTCTCAGGCTCCCAGCGCTTTG GAGCTGTGTGGACAGGGGACAACACTG

CCGAATGGGATCATTTGAAGATCTCTATCCCTATGTGTCTCAGCCTGGCACTGGTGGGGCTTTCCTTCTGTGGAG CGGATGTGGGTGGCTTCTTCAAGA

ACCCAGAGCCAGAGCTGCTTGTGCGCTGGTACCAAATGGGTGCCTACCAGCCGTTCTTTCGGGCTCATGCCCACTTGGACACTGGGCGGCGAGAGCCATG

GCTGTTAGCGTCTCAATACCAAGATGCAATCCGAGATGCCTTGTTCCAGCGATATTCTTTGCTGCCCTTCTGGTATACCCTCTTCTATCAAGCTCACAAG

GAAGGGTTTCCTGTCATGAG GCCCCTCTGGGTACAGTATCCTGAGGATATGTCTACCTTCAGTATAGAGGATCAGTTCATGCTTG GTGATGCACTCCT

TATTCACCCTGTATCGGATGCTGGGGCCCACGGAGTGCAGGTCTATTTGCCTGGCCAAGAAGAA GTGTGGTATGACATTCAGAGCTATCAGAAGCATCA

TGGGCCCCAGACCTTGTATCTGCCAGTAACTTTGAGCAGT ATCCCCGTGTTCCAGCGTGGCGGAACCATTGTGCCTCGATGGATGCGTGTGAGGCGCTC

TTCAGACTGTATGAAGGACGATCCTATCACTCTCTTTGTTGCTCTCAGTCCCCAG GGTACTGCCCAAGGAGAGCTCTTTCTAGATGATGGACACACCTT

TAACTATCAGACTCGCCATGAGTTCCTGTTGCGGCGGTTCTCTTTCTCTGGCAGCACACTGGTCTCTAG TTCAGCAGACCCCAAAGGCCACCTTGAGAC

ACCTATTTGGATTGAGCGAGTAGTCATCATGGGGGCTGGAAAGCCAGCAGCTGTGGTGCTCCAGACCAAAG GATCCCCTGAAAGTCGCCTGTCCTTCCA

GCATGACCCTGAGACCTCAGTGCTGATATTGCGTAAACCTGGTGTCAGCGTGGCATCCGACTGGAGTATTCATCTTCGATAACCCAAGGAACTTGTTCTG

AGTTGGGAGGAAGGGCATGATGGTATTGAGTTACCTTTTCTTTTGCCTTGGAGTTTGACCCTACCTAGATTTCACCTTCTAATTCTACGACCCAGATTCT

GTCAACATCTGGGCAAGATGACAGGGCTGTCCTAGGGCTCTGAATTCCACTTGTGACCTAGTCTTTCCTTCTGTGTGTTACCAAGCCCTTCATACTCAGT

ATCCTGTTGCTGTAACTGGAGCACAGTCATTTGTGAAGACCAAGGGGCCTTGTCGTTCTTTTTCTCTTCCTTAGGGTCCCTACCTTCTCCTTAGACCCCA

TCTATTCAAGCCTCTTGTTTGTTGATGCCATTTCTTGGAAGAAGATGAGGGCAGTGAACATTAGGGTTCCTTTTCTTCTTCCCTGTTCCCTCCTATCCAA

AATGCCCATCCTTTCATTCCTTCCCCTGAATGTCCCCTTCTCTGTTCCACTGATACACTGGGACCACCCCTTACTTGGTAAGGGACAAATGGATCAAGAT

TGAGGTTCCTGGAGAACGTCCTCTTCCTTCTCATCTCAACCTTGTCTTCCTGTTTCTTTCCAGAGCTGCTGCATTTCTCCCATCTTAGAGGGAGACGCTT

CCACACAATTAGGAGGGCAAGGTTATTAAACTTCTTTTGCCCCTCTGGTCCCCTTGGGACACTCAAGATAGAGACATGAGTTGTGGTTTCACTGAATCAC

GGTCACCTGTATTTATTGCTGGGAAGAAGACTGAGGGTGGGGGGAGACGATCATGTGTACCCAGGGGTGGCTTCAAGCCCTGGTAAGCGGGTTGAGGGAG

GACTCAGGAACCAGGAGAACTATTTGTGGGAATTTTTTTTACTTCCTCTGGGTTCCCAACTGTGACAAGTTTTGATAAAAAGGAGAAACAATAAAAAACG

AAACAAAACAT
Translation
MAAIAAVAARRRR - UNI6848 - RSWLSLVLAYLGVCLGITLAVDRSNFKTCDESSFCK - UNI19895 - KRQRSIRPGLSPYRALLDTLQLGP

DALTVHLIHEVTK VLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLVADPPTAR RLSVSGRDDNSVELTVAEGPYKIILTAQPFRLDLLEDRSLLL

SVNARGLMAFEHQRAPRVP PFSDKVSLALGSVWDKIKNLFSR RQESKDPAEGNGAQPEATPGDGDK PEETQEKAEKDEPGAWEETFKTHSDSKPYG 

GPTSVGLDFSLPGMEHVYGIPEHADSLRLKVTE EGGEPYRLYNLDVFQYELNNPMALYGSVPVLLAHSFHRDLGIFWLNAAETWVDISSNTAGK TLFG

KMLDYLQGSGETPQTDIRWMSESGIIDVFLMLGPSVFDVFRQYASLTG GTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHNMPCDVIWLDIEHAD

GKRYFTWDPTRFPQPLNMLEHLASKRRK LVAIVDPHIKVDSGYRVHEELRNHGLYVKTRDGSDYEGWCWPG GSASYPDFTNPRMRAWWSNMFSFDNYE

 GSAPNLYVWNDMNEPSVFNGPEVTMLKDAVHYGGWEHRDIHNIYGLYV HMATADGLIQRSGGIERPFVLSRAFFSGSQRFG GAVWTGDNTAEWDHLK

ISIPMCLSLALVGLSFCGA ADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLASQYQDAIRDALFQRYSLLPFWYTLFYQAHKEGFPV

MR RPLWVQYPEDMSTFSIEDQFMLG GDALLIHPVSDAGAHGVQVYLPGQEE VWYDIQSYQKHHGPQTLYLPVTLSS IPVFQRGGTIVPRWMRVRRS

SDCMKDDPITLFVALSPQ GTAQGELFLDDGHTFNYQTRHEFLLRRFSFSGSTLVSS SSADPKGHLETPIWIERVVIMGAGKPAAVVLQTKG GSPESR

LSFQHDPETSVLILRKPGVSVASDWSIHLR

For any suggestions or comments, please send an email to unitrap@crg.es