Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071652 (Ints5)
Chromosomal location
Chr 19: 8967505 - 8972371 (+)
Description
integrator complex subunit 5 Gene [Source:MGI Symbol;Acc:MGI:1923578]
RefSeq_dna
NM_176843 
RefSeq_peptide
NP_789813.1 
UniGene
Mm.290474 Mm.469233 
MGI
MGI:1923578 
Uniprot/SWISSPROT
Q8CHT3 
Human Ortholog
ENSG00000185085 (INTS5)
Omim not available
UniTrap UNI17521
Vector Insertion
Chr 19: 8967639 - 8969248
Public Clones (sanger) IST14711G2 (tigm) IST14375H4 (tigm) IST14838A4 (tigm) IST10513F2 (tigm)
IST10453F1 (tigm)
Private Clones OST441192 (lexicon) OST378211 (lexicon) OST347417 (lexicon) OST346168 (lexicon)
OST309413 (lexicon) OST269683 (lexicon) OST219815 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096249
Sequence
ATGCGTCGCCTGTGCTCCGCCGCTCCCGCCTCAGGCTCCGGGTAGGGCTCCGGGATGTCCGCGTTGTGCGACCCTCCCGGGGCCCCAGGGCCACCCGGGC

CTGCCCCCGCCACCCACGGTCCCGCGCCTCTCAG - UNI17521 - TGCTCAGGAGCTGTCCCAAGAAATCAAGGCTTTTTTGACCGGTGTAGACCCT

ATTCTGGGCCACCAGCTCTCAGCTCGTGAACATGCTCGATGTGGTCTTCTCTTGCTCCGTTCTTTGCCACCTGCTCGGGCTGCTGTGTTGGACCACTTGA

GAGGTGTTTTTGATGAGAGTGTCCGGGCCCACCTAGCTGCCCTAGAAGAAAGTCCTGTGGCTGGTCCACCTCACCTCCGTCCACCTCCACCATCCCATGT

CCCTACTGGTGGACCTGGCTTAGAGGATGTGGTGCATGAAGTGCAGCAGGTGCTGTGTGAGTTTATCCGGGCCAACCCAAAGGCCTGGGCACCCGTGATT

AGTGCATGGTCCATTGACCTCATGGGACAACTGAGCAGCACATATTCAGGTCAGCATCAGCGTGTTCCCCATGCCACTGGCTCTCTCAATGAACTGCTGC

AGCTGTGGATGGGCTGCAGGGCCACCCGCACATTAATGGACATCTATGTGCAGTGCCTCTCGGCCCTCATTGGTAGCTGCCCAGATGCATGTGTGGATGC

CTTGCTAGACACTTCTGTCCAGCATTCCCCACACTTTGACTGGGTTGTGGCCCATATTGGCTCTTCTTTTCCTGGCACCATCATCTCCCGAGTCCTATCT

TGTGGCCTTAAGGACTTCTGTGTCCATAGTGGGGCTGGAGGAGGAGCTAGTGCTTGTGGAAACTCTTCTCAACCCCCCTCTACAGACCCCTTCCCTGGAT

CTCCTGCCATCCCTGGGGAAAAACGGGTACCCAAGATTGCCTCAGTTGTAGGCATCCTAGGGCACCTGGCTTCCCGCCATGGAGACAGCATCCGACGGGA

ACTGTTGCGCATGTTTCATGATAGTTTGGCAGGGGGTTCTGGGGGCCGGAATGGAGAGCCCTCTCTTCAGGCCACAGTTCCCTTCCTACTGCAGCTGGCA

GTCATGTCACCAGCTTTGCTCGGCACAGTATCTGGAGAACTTGTGGACTGCCTCAAGCCCCCAGCAGTGCTAAGCCAGCTGCAACAACACCTGCAGGGGT

TCCCCAGAGAAGAGCTAGACAACATGCTAAACCTGGCTGTGCATCTAGTGAGCCAGGCCTCTGGGACTGGTGCCTACCGCCTGCTGCAGTTCTTAGTAGA

CACAGCTATGCCTGCTTCAGTTATTACTACCCAGGGCCTGGCTGTGCCAGACACCGTGAGAGAGGCCTGTGACCGGCTGATCCAGCTGCTATTGCTACAT

CTACAAAAACTAGTTCATCATCGGGGAGGGTCTCCTGGAGAAGGGGTGCTGGGCCCACCCCCACCTCCTCGTCCAGTGCCCTTTCTTGATGCATTACGAA

ACCATGTTGGAGAACTGTGTGGAGAGACATTACGGCTAGAACGGAAGCGCTTCCTCTGGCAACACCAGCTCCTGGGCCTACTGTCTGTCTATACACGACC

TAGCTGTGGACCTGAGGCCTTGGGTCATCTACTGAGCAGAGCCAGAAGCCCTGAAGAGTTGAGTTTGGCAACCCAGCTATATGCAGGGCTAGTGGTCAGT

CTCTCTGGCCTTCTTCCCCTGGCCTTCCGAAGCTGCCTGGCTCGAGTGCATGCAGGGACTTTACAGCCTCCCTTCACAGCCCGGTTTCTTCGAAATTTGG

CCTTGTTGGTGGGGTGGGAGCAGCAGGGTGGTGAGGGCCCTTCAGCCTTAGGGGCCCGGTTTGGGGAGTCTGCCTCAGCTCACCTGGCTGATCTGGCTCC

TCTCCTACTACACCCAGAGGAGGAAGTAGCTGAAGCTGCTGCCTCCCTCCTTGCAATATGTCCCTTTCCTTCTGAAGCCCTGTCCCCTTCCCAACTATTG

GGACTAGTGAGAGCTGGAGTACACCACTTCTTCTCTTCTCTAAGGCTGCATGGCCCTCCTGGTGTGGCTTCAGCCTCTCAGCTTCTTACCCGCCTTTCTC

AGACTTCCCCAGCTGGGCTCAAGGCTGTCCTACAGCTGCTTGTAGAGGGAGCCTTACATCGGGGCAACACAGAACTATTTGGAGGGGAAATGGATGGAGA

CAATGAGACCCTCTCAATTGTCTCAACCCCTTTGGCTTCTGCCTCATTGTTGGACATTAACCGGAGGCATACTGCAGCAGTGCCGGGTCCTGGAGGGATC

TGGTCAGTTTTCCATGCTGGAGTTATCGGCCGTGGCTTAAAGCCACCTAAAATTGTTCAATCTCGAAACCATCAAGAAGTGATCTATAACACCCAGAGCC

TCGTTAGCCTCCTAGTGCACTGCTGCAGCGCATCAGGGAACAGCGAGCGTGAGGGTTGCTGGGGGGCTCCCACCCTGAGCCCAGAGGCAGCCAAAGCAGT

TGCGGTGACCTTAGTGGAGAGCGTGTGTCCTGATGCAGCTGGTGCTGAGCTGGCCTGGCCCCCAGAGGATCATGCACGAGCCACCGTGGAGCGGGATCTC

CGAATTGGTAGGCGCTTCCGGGAACAACCTCTGCTGTTTGAGCTTTTGAAGCTGGTAGCAGCTGCTCCCCCAGCCCTGTGCTACTGCTCCGTGCTGCTGC

GGGGGCTGCTGGCTGCCCTCTTGAGCCATTGGGAAGCCTCTCGACACCCTGATACAACCCACTCCCCCTGGCATCTGGAGGCATCCTGTATCCTGGTGGC

TGTCATGGCTGAGGGAAGCCTCTTGCCACCAGCCCTGGGTAATATGCACGAGGTATTTAGCCAACTGGCACCTTTTGAAGTGCGTCTGTTGCTGCTTAGT

GTCTGGGGTTTTCTTCGGGAGCATGGGCCCTTGCCCCAGAAGTTCATCTTCCAGTCTGAACGTGGCCGCTTCATCCGGGACTTTGCCAGGGAGGGTGGAG

CTGAAGGAGGACCACATCTGTCTGTGCTGCACAGTGTCCTCCACCGCAACATCGATCGCCTGGGGCTCTTCTCTGGCCGCTTTCAAGCACCTCCGCCATC

CACTCTGCTTCGGCAGGGGACTTGACCTTTTCTCTACAAGTTGTGCGAGGTTAAACTGAGAGAAGAGCCTAAGGTGCTACAGAAGGGTGGATGCTTCTAA

GTCCGTACGTAATGAGTGGTGTCACTTTTTTCAAACCCCACCATTTTTTCTAAATAAAATTTGCCGAGTTG
Translation
MSALCDPPGAPGPPGPAPATHGPAPLS - UNI17521 - SAQELSQEIKAFLTGVDPILGHQLSAREHARCGLLLLRSLPPARAAVLDHLRGVFDESV

RAHLAALEESPVAGPPHLRPPPPSHVPTGGPGLEDVVHEVQQVLCEFIRANPKAWAPVISAWSIDLMGQLSSTYSGQHQRVPHATGSLNELLQLWMGCRA

TRTLMDIYVQCLSALIGSCPDACVDALLDTSVQHSPHFDWVVAHIGSSFPGTIISRVLSCGLKDFCVHSGAGGGASACGNSSQPPSTDPFPGSPAIPGEK

RVPKIASVVGILGHLASRHGDSIRRELLRMFHDSLAGGSGGRNGEPSLQATVPFLLQLAVMSPALLGTVSGELVDCLKPPAVLSQLQQHLQGFPREELDN

MLNLAVHLVSQASGTGAYRLLQFLVDTAMPASVITTQGLAVPDTVREACDRLIQLLLLHLQKLVHHRGGSPGEGVLGPPPPPRPVPFLDALRNHVGELCG

ETLRLERKRFLWQHQLLGLLSVYTRPSCGPEALGHLLSRARSPEELSLATQLYAGLVVSLSGLLPLAFRSCLARVHAGTLQPPFTARFLRNLALLVGWEQ

QGGEGPSALGARFGESASAHLADLAPLLLHPEEEVAEAAASLLAICPFPSEALSPSQLLGLVRAGVHHFFSSLRLHGPPGVASASQLLTRLSQTSPAGLK

AVLQLLVEGALHRGNTELFGGEMDGDNETLSIVSTPLASASLLDINRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKIVQSRNHQEVIYNTQSLVSLLVHC

CSASGNSEREGCWGAPTLSPEAAKAVAVTLVESVCPDAAGAELAWPPEDHARATVERDLRIGRRFREQPLLFELLKLVAAAPPALCYCSVLLRGLLAALL

SHWEASRHPDTTHSPWHLEASCILVAVMAEGSLLPPALGNMHEVFSQLAPFEVRLLLLSVWGFLREHGPLPQKFIFQSERGRFIRDFAREGGAEGGPHLS

VLHSVLHRNIDRLGLFSGRFQAPPPSTLLRQGT

For any suggestions or comments, please send an email to unitrap@crg.es