Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000071856 (Mcc)
Chromosomal location
Chr 18: 44589118 - 44971836 (-)
Description
mutated in colorectal cancers Gene [Source:MGI Symbol;Acc:MGI:96930]
RefSeq_peptide
NP_001078842.1 NP_001078843.1 
UniGene
Mm.312511 Mm.476639 
MGI
MGI:96930 
Uniprot/SPTREMBL
Q3TYX4 
Human Ortholog
ENSG00000171444 (MCC)
Omim not available
UniTrap UNI31033
Vector Insertion
Chr 18: 44884118 - 44919075
Public Clones (sanger) IST11807D12 (tigm) IST12313G10 (tigm) IST14508B4 (tigm)
IST11003F1 (tigm) IST14594C12 (tigm) IST12072F10 (tigm) IST10843H5 (tigm)
IST12927E1 (tigm) IST12788G8 (tigm) IST11548D6 (tigm) IST10461D7 (tigm)
IST15073B2 (tigm) IST10176B8 (tigm) IST10923H6 (tigm) IST12271G3 (tigm)
IST11028D2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12212
Vector Insertion
Chr 18: 44693955 - 44884118
Public Clones D062B07 (ggtc) W197F04 (ggtc) IST10322A3 (tigm) IST15104E4 (tigm)
IST15101H11 (tigm) IST12078A12 (tigm) IST12592E3 (tigm) IST10545G2 (tigm)
IST14472E8 (tigm) IST13750C10 (tigm) IST13066C11 (tigm)
Private Clones OST286155 (lexicon) OST119093 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089874
Sequence
TCCTCCGGGCGGGAGCGCGATGGCGGCTGCAAGCGCCTGCAACAGCAGCGGTGGCAGCAGCGACACGTCCAGCACCGGCGAGGAGGAGCGACTGCGGCGG

CTCTTCCAGACGTGCGACGGCGACGGCGATGGCTACATCAGCAG - UNI31033 - GAATGACTTGCTAATGGTCTGCAGACAGCTGAGCATGGAAGA

GTCAGTGGCTGAGATCATGAACCAATTGGGCTCAGATGAAAACGGGAAGATTTCCTTCCAAGACTTCACAAGGTGCCACACGCAGCTTGTTAGAGAAATT

AGGAAGGAGGAAGGAGACCTCTCCATGAAATCAGACATGTCCAGTACAAAGAGGCTGAGTGAGAGAATCACCTCCTGGCCCACGAGCAGTGACAACAGTC

TGG - UNI31033 - GTGCTTTGTCAGCAGCCAGGGAGAGCTGGGAGGATGATTCTGGTGCCAGGGATCTCCAGAGCCCGGACTTGCAGAGCCAGCGG

CCCCTCCAGAAGCTGCTGGAGTATGGCGGAAGCTCTTTGCCTCAGCAGGCTGTGCTCCACAAGCTTCTCACACACGCCCCGAATTTTGGCACCTCTACAG

GCGGAAGCTATCTAGAGCTGGCCAGCACC - UNI12212 - - UNI31033 - CTCCACTTGGCAGCCCTGGCATCACTCAAGGGAGACATTGTAGA

GCTGAATAAGCGTCTGCAGCAGACAGAGCGGGAACGCGACCTCCTGGAAAAGAAGTTGGCCAAAGCACAG TGTGAGCAGTCACACCTCATGAGAGAGCA

TGAAGACGTCCAGGAGCGCACGACACTCCGCTATGAGGAGCGCATCACAGAACTCCACAGTATCATTGCAGAACTCAACAAGAAGATAGACCGCCTGCAA

GGTACCACCATCAG GGAGGAAGATGAGTACTCAGAACTTCGGTCAGAGCTCAGCCAGAGTCAACAAGAGGTTAATGAAGACTCCAGAAGTGTGGACCAA

GACCAGACCTCTGTGTCCATCCCTGAGAACCAGTCTACTATGGTCACTGCTGATATGG ATAACTGCAGTGACTTGAACTCAGAACTGCAGAGGGTGTTG

ACCGGTCTGGAGAGTGTCGTCTGCGGCAGGAAGAAGAGCAGCTGTAGCCTCTCTGTGGCCGACGTTGACAGGCACATAGAGCAGCTCACCACGGCCAGCG

AGCACTGCGACTTGGCCATTAAG ACAGTTGAGGAGATCGAGGGCGTTCTAGGTCGCGATCTGTATCCCAACCTGGCTGAGGAGCGGTCCCGGTGGGAGA

AAGAGCTGGCTGGACTGCGGGAAGAGAACGAAAGCCTGACGGCCATGCTATGCAGCAAAGAGGAGGAGCTGAACCGGACCAAGGCCACTATGAACGCCAT

CCGTGAGGAGCGGGACAGGCTTCGGAGGCGG GTCCGAGAGCTCCAAACTCGGCTGCAGAGTGTGCAGGCTACTGGACCTTCTAGCCCAGGTCGCCTCAC

CCCTGCCAATCGCCCAATCAACCCCAGCACCGGAGAGCTAAGCACCAGCAGTAGCAGCAATGACATCCCCATCGCTAAG ATTGCTGAGAGAGTGAAGCT

GTCAAAGACGAGATCTGAATCGTCATCATCTGATAGGCCAGTCCTGGGCTCGGAAATCAGTAGCATCGGG GTTTCCAGCAGTGTGGCAGAACACCTGGC

CCACTCACTCCAGGACTGCTCCAACATCCAGGAAATTTTCCAGACACTCTACTCACACGGATCTGCCATCTCTGAAAGCAAGATTAGAGAGTTTGAGGTG

GAAACGGAACGATTGAATAG TCGTATTGAACACCTCAAATCCCAAAATGACCTTCTCACCATAACCCTGGAGGAATGTAAAAGCAACGCCGAGAGGATG

AGCATGCTGGTGGGGAAGTACGAATCCAACGCCACAGCCCTGAGGCTGGCCTTGCAGTACAG TGAGCAGTGCATAGAAGCCTATGAACTCCTGCTGGCC

CTGGCTGAGAGCGAGCAGAGCCTCATCCTGGGGCAATTCCGAGCAGCTGGTGTGGGCTCCTCCCCTG GAGACCAGTCAGGGGATGAAAATATCACTCAG

ATGCTCAAGCGGGCTCATGACTGCCGGAAGACTGCTGAGAACGCCGCCAAAGCCCTGCTCATGAAGCTGGATGGCAGCTGCGGGGGAGCCTTCGCCGTGG

CTGGCTGCAGCGTGCAGCCCTGGGAGAGCCTGTCCTCCAACAGCCATACCAG CACGACCAGCTCTACAGCCAGCAGCTGTGACACAGAGTTCACTAAGG

AAGATGAGCAAAGGTTGAAGGATTATATCCAGCAGCTCAAGAATGACAGAGCCGCCGTCAAGCTGACCATGCTGGAGCTGGAGAGCATCCACATCGATCC

ACTCAGCTATGATGTCAAGCCAAGAGGCGACAGCCAGAGGCTGGACCTGGAAAATGCCGTGCTGATGCAGGAGCTGATGGCCATGAAG GAGGAGATGGC

TGAGCTGAAGGCCCAGCTCTATCTACTGGAGAAGGAGAAGAAAGCCCTGGAGCTGAAGCTGAGCACGAGGGAGGCGCAGGAGCAGGCCTATCTGGTGCAC

ATCGAGCATCTCAAGTCCGAGGTGGAGGAGCAGAAGGAGCAGAGGACGCGGTCTCTGAGCTCCACCAGCAGCAGCGGCAAGGAGAAGCCTGGCAAG GAG

TGTGCCGATGCTGCCTCTCCAGCTTTGTCACTTGCCGAACTAAGGACGAACAGCGACAGTGAGCTGGCCACCGAGTTCGCCAATGCCATCCGACG GGAA

AAGAAGCTGAAGGCCAGAGTCCAAGAACTGGTCAGTGCCTTGGAAAGACTAACCAAAAGCAGTGAAATCAGACACCAGCAGTCAGCAGAGTTTGTTAATG

ACCTGAAACGGGCCAACAG CAATCTGGTGGCTGCTTACGAGAAAGCAAAGAAGAAGCATCAAAACAAGCTGAAGAAGCTGGAATCTCAGATGATGGCCA

TGGTGGAGCGACACGAGACCCAAGTGAGAATGCTCAAGCAAAGAATAGCCCTGCTGGAGGAAGAGAATTCCAGGCCACACACCAACGAAACGTCACTCTA

ACAGGCACTCTGGCACCAAAGTTGGCTAACCTGGAGCAGCTCTGGAGTCCTCAGAAGAGGAAGGGCCCAGAGAAGGAGGGACTGTTGGGAGAAGAGTGGA

AAGGTTGCATATAGGTCACGGGCTCCACCCTGGGGGGCGTGGTCACGACGGCACTGTGGATTATGTACCTATGTACTGGCTCCAGCTGCTCTTGGCTTGG

CCACAAAGGGTGTCCACAATGGCTCCAGCCTCAAGATTAGCCACAACTTCTTTCAGAGTTCACCATTCCAGTTCTCAACTGTTCTGTGCAGTAGTGGAAA

TCCAGGCATCTGTGGATTTCCAAGTCTACCCATCCCCACCCCTGCCTCCTTTTTTTTTTTTTTTTTCCCATAGGTTGTTGACTTTTCTTTTGACACCTGG

ATTTCTTCCTGCCTCTTCCAAGGG
Translation
 - UNI31033 - MSSTKRLSERITSWPTSSDNSLG - UNI31033 - GALSAARESWEDDSGARDLQSPDLQSQRPLQKLLEYGGSSLPQQAVLHK

LLTHAPNFGTSTGGSYLELAST - UNI12212 - - UNI31033 - LHLAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQ CEQSHLMREHED

VQERTTLRYEERITELHSIIAELNKKIDRLQGTTIR REEDEYSELRSELSQSQQEVNEDSRSVDQDQTSVSIPENQSTMVTADMD DNCSDLNSELQRV

LTGLESVVCGRKKSSCSLSVADVDRHIEQLTTASEHCDLAIK TVEEIEGVLGRDLYPNLAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMN

AIREERDRLRRR VRELQTRLQSVQATGPSSPGRLTPANRPINPSTGELSTSSSSNDIPIAK IAERVKLSKTRSESSSSDRPVLGSEISSIG VSSSVA

EHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERLNS SRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYS SEQCIE

AYELLLALAESEQSLILGQFRAAGVGSSPG GDQSGDENITQMLKRAHDCRKTAENAAKALLMKLDGSCGGAFAVAGCSVQPWESLSSNSHTS STTSST

ASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSYDVKPRGDSQRLDLENAVLMQELMAMK EEMAELKAQLYLLEKEKKALELKLST

REAQEQAYLVHIEHLKSEVEEQKEQRTRSLSSTSSSGKEKPGK ECADAASPALSLAELRTNSDSELATEFANAIRR REKKLKARVQELVSALERLTKS

SEIRHQQSAEFVNDLKRANS SNLVAAYEKAKKKHQNKLKKLESQMMAMVERHETQVRMLKQRIALLEEENSRPHTNETSL

For any suggestions or comments, please send an email to unitrap@crg.es