Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000072511 (Hhla1)
Chromosomal location
Chr 15: 65754005 - 65808366 (-)
Description
HERV-H LTR-associating 1 Gene [Source:MGI Symbol;Acc:MGI:3615329]
UniGene
Mm.364550 
MGI
MGI:3615329 
Uniprot/SPTREMBL
Q3TYV2 
Human Ortholog
not available
Omim not available
UniTrap UNI29765
Vector Insertion
Chr 15: 65755421 - 65761868
Public Clones D059G02 (ggtc) (ggtc) E079F05 (ggtc) E046D10 (ggtc) D131G08 (ggtc)
3SE386F10 (ggtc) E058F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100584
Sequence
CTAATCTTCTTGGCTGTCTAAATTCTTTGAAGTCATTCATCCTGCTCAGGAGACCG GTTGTCAAGGCTTCCAAGCATGCAGAGCTTCCTGCTTCATTGT

CCTCCAATAAGGCTGTGTATGGGCCTTGCCTGTATCCTCTTTCTCTGGAATGCAG TGTCTGGTCTTAAAGGAGAAGGCAAGAAAGATAAAGAAATGGCT

CTCCCACCTGCAACAG TGTCTGGAAATGAAGGCCTCAAGAAGGAGAAAAACGGATCCTTTCTTCATGCAGCAG AGTCTGTCTTCAAAGAAAAAAAGAT

GGTAAAGGGATTAGAGGTTCTTGCAACTACAG AACTCCCAGCAAGGTCAGTGGATCTGTCTACACTCAACCTGACCGAGCTTGTGAATGGCATGCTCAA

TAGAGCTTTAAAAG ATAGCAAGCAATTCTTCTCCGTACTTAGCATCACTTCTTATAGTTCATTTGCCTTTCACAAGGTTTCCGTGGCCATCTACAACA 

TTTCCAACCCAAAGACAGTCGACCCAGCCAAATTCCCTACCCGGCACTGCTACTGTTTGAGCAATAGGACCAATGACTTATCAG ATTTCACAGCATTGC

TGGTGGACATTGTTGGAAATTCTACAAGCTACCTCACTGAGATTTTTAAGTCAACCTCCATCCTCTCTG TGACTCAGACCAATGAATCGGACTGTGTCT

TCATCTGTGTGATGGTGGGAAAGTCAG GAAGGAATCTTTCTGACTTCTGGGAGATGGTGGAGAAATCCCCTGTTATCAACTACACATTTACCAGTGGTG

TGTCCAGTGTTTTAG CAACTACCAGGGGAACAGCAAGGACTTCAAGGCTCACAACTCAAAGCCAGCAGTCACTTCTAAGACCATATTCTGTACGCTGGA

GCACACAATGGGTATCTGCTCTGAAGTCTCTCCCCTGGACAAAGACAAGTGCTCCTTCAGAGAAAGAGTTGGCAGAAAGCAAACAGATGTTTCCAGAGCT

TCCTGTTGGGACCATAGGCACACACAGTAGTGCCCCAAGCTCAA GTAACATGACCAGAACACCATGGGGGACAAATAGATACACACAAGCACCTACAGT

ACCCATGCCTATGCCACTAAGTGTGGATGATAGCACACCTGAAGGACCACCCTGGGCAAGCCTTCCCTCCACATCAGCCTCCATTGAAGATGCCCAGCAG

CTCAGGAGCACAGGAAATCTGTTGCATCCTACTGGAATACTGACTACACCCAGCCGACTAGCACAGCCCAGCAGGGCCTCGG GAACACTCATGCCTGGA

ACACAGACTACAAACCCAACCCAAGCACCAGCTCCTAGAGTCCCTCAGACAG - UNI29765 - ATGGTATTCCTGCAGAGTGGCCATTCATCCCTGA

GAAAGAGCCAGCCCGGGACCCAGCAGCCCATCAAGTTTCAA - UNI29765 - AGTGTCCTCGGCCACTCCTCCAAGAAGAGGCCATTACAGATACTC

CTCTGCCCCTGGCCATGAAGAAACTCACCCCATGTCTGATGGAACTCTGCCGCTTCTTCCAGCAATGCCTCTGTGCAATCCAAAAGCGGGATTTCAGTTC

AGAAGCCATAAG - UNI29765 - CAATTGTTACCTGCCAGAGAAAATCAGGAAGCTGATCACACTTCATTAGAGGATCTAGGCATAGCTGTCTTCCA

GTACTGATAGAAGATGCTCCTGGGCTTCATTCTGGATTGTTAAACAGTAGAAATGCATGTCCTTCCCCAGTAAGCGGAGGACCAATTTCTCAAGTCTCAG

GGTTATCATAAAACCTTACTAACTTTATCTTTCATTTTTTAAATCTCCATTATCCACCAAATCTGAGCACCAATCCCAGGTTTGTACCCTTTCCCCTAAT

CTGTTTTTAGATTTGATCTAGGTTGCCTCAATAGCCTTGGGTGTTTTATTTAAATGAAGAGGGGAATAAACAAGTTGACAGACTCAGGAATGTAAACAGA

CAAGGAAGATATCCTCTGTACCAGTGATGTCCTGCCCCCAGTGCATTTCTTCACAGTGAAGAAAAGGAAAAATTTCAAAACAATACTTTTTGTATTATCT

AGAGTCAGCCCACTTCAACAGATTTTTCTCTCACTAACTGAAAGTGTGTTGAGTCTCTACTTTCTGTCAGTCGTGTATTATACTAAGGCAAGTGTTGTAA

AGATGAATTACAAATAGATCTAGGAACTGGGTCATAGTTGGCTGGTGGGACATTATAGTTGTAAAGCTCAAGTTAAAATAAAAATAAAAGTGATAGGACT

AAGTCACCTATCCAAGC
Translation
 MQSFLLHCPPIRLCMGLACILFLWNAV VSGLKGEGKKDKEMALPPATV VSGNEGLKKEKNGSFLHAAE ESVFKEKKMVKGLEVLATTE ELPARSV

DLSTLNLTELVNGMLNRALKD DSKQFFSVLSITSYSSFAFHKVSVAIYNI ISNPKTVDPAKFPTRHCYCLSNRTNDLSD DFTALLVDIVGNSTSYLT

EIFKSTSILSV VTQTNESDCVFICVMVGKSG GRNLSDFWEMVEKSPVINYTFTSGVSSVLA ATTRGTARTSRLTTQSQQSLLRPYSVRWSTQWVSAL

KSLPWTKTSAPSEKELAESKQMFPELPVGTIGTHSSAPSSS SNMTRTPWGTNRYTQAPTVPMPMPLSVDDSTPEGPPWASLPSTSASIEDAQQLRSTGN

LLHPTGILTTPSRLAQPSRASG GTLMPGTQTTNPTQAPAPRVPQTD - UNI29765 - DGIPAEWPFIPEKEPARDPAAHQVSK - UNI29765 -

 KCPRPLLQEEAITDTPLPLAMKKLTPCLMELCRFFQQCLCAIQKRDFSSEAIS - UNI29765 - SNCYLPEKIRKLITLH

For any suggestions or comments, please send an email to unitrap@crg.es