Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000072609 (AC138113.3-202)
Chromosomal location
Chr 14: 42872700 - 43018480 (-)
Description
not available
Human Ortholog
not available
Omim not available
UniTrap UNI32314
Vector Insertion
Chr 14: 42873449 - 43017331
Public Clones (sanger) IST14576F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100698
Sequence
TCAGATCCTCATGGGTTCCCAAGCAGGCATGTTGTCCATGCTCCTCAGGGTATTTCAGAGAGAGAATAGAATACACACAGACACCAGACCAAGGCAGAAG

GAGGCCGACCGCCCATCATGGTGGGAAAGGGCAAGAAACAACTGGTCATGGAGAAG - UNI32315 - GGTCTGCTGGGGAGGCATCACAGCAAGCCC

CCACCATCAATGAGCAGGAGAAGAGACACGAGAGGTTGGAGAAGCTCAAAAGAGAGCTCCAGAACATAAAAAATGCCAGAGACGAACTTCAGGGAATCCT

GGCCAACTACACTAACAAGGATTTAAATGACAG - UNI32315 - GATCAACTTTGAGACATTCATGCTTGAGATGCAACATGACCAGGTGATGACTG

ACCTGAAGTGTATGCCCCAGGACATCAGTGAGGCCTTGTACAAGTGCAAGCAGTTGACTAAAGAAAATCAGTTCTACTG - UNI32315 - CTTCAGG

AACTGCCACCTCCTGATTGAATCTAACCTCATCCAGCACAAAGTCAGGATGTTGAGGAAGGAGAACAGACAGCTGCTAAGGGAGCAG
Translation
RSSWVPKQACCPCSSGYFRERIEYTQTPDQGRRRPTAHHGGKGQETTGHGEG - UNI32315 - GSAGEASQQAPTINEQEKRHERLEKLKRELQNIK

NARDELQGILANYTNKDLNDR - UNI32315 - RINFETFMLEMQHDQVMTDLKCMPQDISEALYKCKQLTKENQFYC - UNI32315 - CFRNCH

LLIESNLIQHKVRMLRKENRQLLREQ

For any suggestions or comments, please send an email to unitrap@crg.es