Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000072731 (5033421C21Rik)
Chromosomal location
Chr 14: 7977121 - 8077221 (-)
Description
RIKEN cDNA 5033421C21 gene Gene [Source:MGI Symbol;Acc:MGI:1923213]
Human Ortholog
not available
Omim not available
UniTrap UNI35280
Vector Insertion
Chr 14: 7991737 - 8077222
Public Clones IST11068E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100890
Sequence
AGAACTCCGTGTCCCTGCGCTCCGTCGGTCACCAGGCGCGGGCCGGCATGATGGAGCCGCAGCATGTGCACCATGTGCTTGGAGCCCAGAGCCCAGCCTG

GGAGGAACTG - UNI35280 - GATCTGCTAGAAATACTTCAACCCAAAAGTCCAAAATCACTAAGCAGAAATCAAATATAAATGAACTAGAAGAATT

GAATTTGGATATGAGGAAGATCAGTAATGACATGGAGGAAATGTGTGGAATCCTGGACCTTTACATGTATGAGGATTTGAACTACAG - UNI35280 -

 GATGAACACTGAATTCAACATCATTAAATCACAACATGAGAAGACAATGTTGGATATGAATAAAATGATCCAGTCCATAATTGGTTCCATGCAGTACTC

CAAGGAACTGATAGAAGATAACTATTCCTACAG GCATGAAGGTCCTCTCCAAGAACTCAGCAAAGCTGGACTGGAACCCAGGCATTTCTTTCTGTTCTC

CTGGAAGTCTGCAGGAAGACAGCTCCTGGGCCTTTTCTTCCTCCAGCCAACCAAGTCTCCTTTACCCAAGGTGACCCTTGGCTTGCAGCGAGAAGGGGGG

CTCAACCTGAGTGGGCTTTTTCCTGAGTCCAACGAGATGCTTCCTTCTCCATACGATTGTCATCTAGCTTCACTTTTCATACTATTTTAA
Translation
ELRVPALRRSPGAGRHDGAAACAPCAWSPEPSLGGTG - UNI35280 - GSARNTSTQKSKITKQKSNINELEELNLDMRKISNDMEEMCGILDLYMY

EDLNYR - UNI35280 - RMNTEFNIIKSQHEKTMLDMNKMIQSIIGSMQYSKELIEDNYSYR RHEGPLQELSKAGLEPRHFFLFSWKSAGRQLLGL

FFLQPTKSPLPKVTLGLQREGGLNLSGLFPESNEMLPSPYDCHLASLFILF

For any suggestions or comments, please send an email to unitrap@crg.es