Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000072742 (AC157601.7-201)
Chromosomal location
Chr 14: 5746793 - 6807313 (+)
Description
Alpha27-takusan  [Source:UniProtKB/TrEMBL;Acc:A6NAU4]
Uniprot/SPTREMBL
A6NAU4 A6NAU6 A6NAU8 A6NAV7 A6NAV8 Q7TMP5 
Human Ortholog
not available
Omim not available
UniTrap UNI30970
Vector Insertion
Chr 14: 5746923 - 6374670
Public Clones IST12800B3 (tigm) IST12413G7 (tigm) IST13353A6 (tigm) IST14130H8 (tigm)
IST12681D7 (tigm) IST12275C4 (tigm) IST10280G5 (tigm) IST12727C11 (tigm)
IST13833D7 (tigm) IST14837F3 (tigm) IST13474A3 (tigm) IST12909G9 (tigm)
IST12018E1 (tigm) IST14643F8 (tigm) IST14270F5 (tigm) IST14463F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090673
Sequence
ATGTTTTCCTGGCTGCTCAGGCTATTTCAGAAAGAGAATGGCGATGAAGGAGAGACCAGACCAACAGAGAAGGAAGAGGGAATCCTTTCTCATGAAAAAG

GAAGAAGGAAATCATTCTGGAGAAGGCACA - UNI30970 - GGTCTGCTAGAAATACTTCAACCCAAAATTCCAAAATGACTAAGAAGAGATCCAAA

AGAAATGAACTAGAAGAACTGAAATTGGATATGAGGAAGATCAGCAATGACATGGAGGAAATGTGTGGAATCCTGAACCTTTACATGTATGAGGATTTGA

ACTACAG GATGAACACTGAATTCAACATCATTAAATCACAACATGAGAAGACAATGTTGGATATGAATAAAATGATCCAGTCCATAATTGGTTCCATGC

AGTATTCCAAGGAACTGATAGAAGATAACTATTCCTACAG CATTAAGGAGGACCACCTCCTCCGTGAGTGCACTCAACTCCACGAAAATGTAAGGATAT

TACTGAATGAGAACAGAAGGCTGCTGGTGGAGCAGGCTGGCCACAAGTGTCCTGTGGGGAAGAAAAGAGGTTCTCTGAGGAGGCCAGCAAGAACATCTGT

GTCCCAAGTCCCAAGGAACAGC
Translation
MFSWLLRLFQKENGDEGETRPTEKEEGILSHEKGRRKSFWRRHR - UNI30970 - RSARNTSTQNSKMTKKRSKRNELEELKLDMRKISNDMEEMCG

ILNLYMYEDLNYR RMNTEFNIIKSQHEKTMLDMNKMIQSIIGSMQYSKELIEDNYSYS SIKEDHLLRECTQLHENVRILLNENRRLLVEQAGHKCPVG

KKRGSLRRPARTSVSQVPRNS
Transcript ENSMUST00000095970
Sequence
ATGTTTTCCTGGCTGCTCAGGCTATTTCAGAAAGAGAATGGCGATGAAGGAGAGACCAGACCAACAGAGAAGGAAGAGGGAATCCTTTCTCATGAAAAAG

GAAGAAGGAAATCATTCTGGAGAAGGCACA - UNI30970 - GGTCTGCTAGAAATACTTCAACCCAAAATTCCAAAATGACTAAGAAGAGATCCAAA

AGAAATGAACTAGAAGAACTGAAATTGGATATGAGGAAGATCAGCAATGACATGGAGGAAATGTGTGGAATCCTGAACCTTTACATGTATGAGGATTTGA

ACTACAG GATGAACACTGAATTCAACATCATTAAATCACAACATGAGAAGACAATGTTGGATATGAATAAAATGATCCAGTCCATAATTGGTTCCATGC

AGTATTCCAAGGAACTGATAGAAGATAACTATTCCTACAG CATTAAGGAGGACCACCTCCTCCGTGAGTGCACTCAACTCCACGAAAATGTAAGGATAT

TACTGAATGAGAACAGAAGGCTGCTGGTGGAGCAGGCTGGCCACAAGTGTCCTGTGGGGAAGAAAAGAGGTTCTCTGAGGAGGCCAGCAAGAACATCTGT

GTCCCAAGTCCCAAGGAACAGC
Translation
MFSWLLRLFQKENGDEGETRPTEKEEGILSHEKGRRKSFWRRHR - UNI30970 - RSARNTSTQNSKMTKKRSKRNELEELKLDMRKISNDMEEMCG

ILNLYMYEDLNYR RMNTEFNIIKSQHEKTMLDMNKMIQSIIGSMQYSKELIEDNYSYS SIKEDHLLRECTQLHENVRILLNENRRLLVEQAGHKCPVG

KKRGSLRRPARTSVSQVPRNS

For any suggestions or comments, please send an email to unitrap@crg.es