Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000072779 (Vmn2r25)
Chromosomal location
Chr 6: 123772832 - 123803208 (-)
Description
vomeronasal 2, receptor 25 Gene [Source:MGI Symbol;Acc:MGI:3644645]
UniGene
Mm.476633 
MGI
MGI:3644645 
Uniprot/SPTREMBL
Q3UXB9 
Human Ortholog
not available
Omim not available
UniTrap UNI13799
Vector Insertion
Chr 6: 123778589 - 123789312
Public Clones CMHD-GT_250E1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073948
Sequence
ATGAAATTACTCATTGCTTTCTCCCCCCTAGTTGTTCTCATTTTATTCCAGGAACATATTTCTTGTTACTACTTAACTAAATATGCTTCTTCTGGCTACT

ATCAAGATGCAGATTTTGTTATTGGAGGACTCTTTTCCCTTAGAGTGACTGATGGAAATACATTTATAAGTAGATCTGGCATTGAAGATACAAGCCATAT

ACCAGAATATGTTTTTGC GGATCTCATTAAACATTATCAGCACATTTTAGCAATGGTTTTTGCTATAGAAAAAATCAACAAGGACCCAAATATTCTATT

CAATAAGTCCCTGGGATTCTTTCTCTTCAATGTCAACTTCATTGAGATGAAGGCTGTGGAAGGTTCTATGGCTTTGCTCTCAGGAGAGAGCCCCCCAATT

CCTAACTACAGCTGCAGGCCTGAAAAGACTGATAAGCTGGTTGCAGTGATAGGAGGCATTTCAACATCAATATCCATTCAGATCTCCCGAGTTCTAAGTC

TCTACAAAGTCCCACAG ATCAGCTATGCTCCTTTTGACCAGATTCTTGGGACCAGAGTCCAGCTTCAGTCTCCTTATCAGTTTTCAATGCACACCGCAG

CTCTGTATCAGGGAATTGTCCAACTGATGTTATACTTCACTTGGATCTGGGTTGGCCTGGTGGTTCCAGATGATATGAGGGGAGAACTCTATCTTAGGGA

TATTACCGAGGAGATGATCAGCCATGGAATTTGTGTTGCATTTGCAGAAAAGGTTACAGAATATTCTAGTAAGAACACAGTAAACTGGAAACGTTTTATG

GAACGATTCACTTTGACACCTGTTATCATTACTTTTGGAGACACACATTCTCTTCTGCGAATTGTCTATTTTGTCATTTTTTATAATCTTTTAGGTAATG

TCTGGATCACAACTTCTGATTGGTATATCACCACATTACCCTTTGAACAGAATTTAATTTATACACACTTTGGTGGAGGATTATCATTTTCATTTCACAT

GGATGAAATTCTGGGATTCAAGGATTTTCTCAGAAGTGTTCAACCTAGAAAATACCCTCATGATATCTTTATCCGGCATGTATGGTCAAGCTTATTTGGA

TGTCCACATTACTACCAACACAGACTCTGGGATCTAAGTCAATGTGAGCCAAATGGCAGCCTGAGCACACGACCTCTGCATGCTTGGGATATGAATACTT

CACCTATGAGCTACAAAGTCCATGCTGCTGTGTATGCCATTGCCCAGGCACTCCATGAGGAGCTGTCACTCAGAGTGGAAGGAGATTCATTTGATAAAGT

TATACTCCAAGCTCCTCATCCATGGAAG - UNI13799 - CTCCATCCATTCCTACAAAAGGGCCAAGTTGGGAGAAGCACCAATGAGGAGTACAGTG

TGAACAAGGAAGTTTCAGCAATCAAGCTTGACATCTTTAATTACCAGTCTCTGCAGAGTGGTACTGAAGCTCATGTGAAGGTTGGCGAATTTGTCTTTGA

ATCTCACAGTGTTCAGCATCTTTCACTAAATGATAAAATAATAACTTGGGGTGAGCACCACAATCAG ACTCCTTTATCTGTTTGCAGTCAAAGTTGTCC

ACTTGGATTTAGCAAAACAGCTGTTGAGGGGAAACCATTCTGTTGTTTTGATTGTGTCCCATGTCCAGATGGAGAAATTGCAAATAAAACAG ATATGCA

TCAATGTATTAAGTGTCCGGAAGATCAGTATCCAAATAAACAGAGGAATCAGTGTCTCCCTAAAATTATGGTATTTTTGGCCCATGAAGATCCACTGGGA

ACTGTTCTTGTCTCCTTGGCCATTAGTTTATCTGCCTTTTCAGCTATGATTCTAGGATTATTTATCTGCTATCGAGAAACACCCATTGTCAGAGCAAATA

ACAGAAATCTCAGTTATCTCCTCCTCATTTCTCTAAAGCTCTGTTTCTTTTGCTCACTAATATTCATTGGCCAACCTAGAACAGTCACTTGTGTCTTGAG

ACAAATTATTTTTGGGATTGTATTTTCCATTGTCATTTCTGCTATCTTGGCAAAGACCTTCATTGTGGTTGTGGCTTTCAAAGCCATCAAACCAGGAAGC

ATCTTAAAAATGGGGATGGTGACCCGACTCTCAAATGCCATAGTCTGCTGTGGTTCCATCATTCAAGTGTGCATCTGTGCAGTCTGGCTGGGAACATATC

CTCCTTTCCCTGATGTTGACATGCAGTCAGAGTTTGGGCAAGTCATCCTCTGGTGTAACGAGGGGTCCACCCTTGCTTTCTATTGTGTTCTGGGGTACTT

GGGCTTTCTAGCCAGTCTCAGCTTGCTTATTGCTTTTCTGGCTAGAAGGCTACCTGACAGCTTCAATGAGGCAAAAACAATCACATTCAGCATGCTGGGT

TTCTGCAGTGTGTGGATTTCTTTCATACCCACTTACCTGAGCTCGAAGGGCAAAACCATGGTGGCCGTGGAAATTCTTTCAATTCTAGCCTCCAGTGCTG

GCTTACTGGGATGTATATTTCTTCCCAAATGCTATGTGATCCTACTGAAGTCAGGTGGTCATTCAAGAAAGAAGTTCTTTAAATGA
Translation
   - UNI13799 -   MGMVTRLSNAIVCCGSIIQVCICAVWLGTYPPFPDVDMQSEFGQVILWCNEGSTLAFYCVLGYLGFLASLSLLIAFLARRLP

DSFNEAKTITFSMLGFCSVWISFIPTYLSSKGKTMVAVEILSILASSAGLLGCIFLPKCYVILLKSGGHSRKKFFK

For any suggestions or comments, please send an email to unitrap@crg.es