Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000072889 (Nfxl1)
Chromosomal location
Chr 5: 72904543 - 72950884 (-)
Description
nuclear transcription factor, X-box binding-like 1 Gene [Source:MGI (curated);Acc:Nfxl1-001]
RefSeq_dna
NM_133921 
RefSeq_peptide
NP_598682.2 
UniGene
Mm.470201 
MGI
MGI:1923646 
Uniprot/SPTREMBL
Q3ULV1 Q9DAE1 Q8K263 Q8R217 
Human Ortholog
ENSG00000170448 (NFXL1)
Omim not available
UniTrap UNI25000
Vector Insertion
Chr 5: 72947585 - 72950252
Public Clones not available
Private Clones OST198495 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074948
Sequence
GCGGCCGCACGGTCAGTTCGCGTTTCTGTGCCTACCGCACTTCTCCTGAGGCTGAGGAGAATTTCCCGTGGCTGGGTTTTTCCTGTCCCGGGTGGGCTCC

TCGTGGCTCCGTGCTTCTTTTCTGCCCTCCGTCTTTTCCCTCCTCGCCCGTCGCTCGAGCCTGGGCTTGGCGGGACTCGCCCTCGGGAGACACAGGGCCG

CAACCTCCTCAGACCCGGGTCTCCGTGTCGCGGGGTCCGTCCGCACCCAGCCTGACCCTGCGGTCCCTCGGCAGCCGCCTCCATCCTCGGACGCCCGTTC

ACGCTCCTTCTCCTTTATCTCTCCGCTGCAGGGATGGACGCTCCCTGGCGCCAGGTGGCCGCTGGCCGAGGCCGAGCCCGAGGACGGGCCACCGCAGTGC

CCCTCTCAGGAAATGGAGTCCCTTTTGGTGGCGCTGGAGGAGGGCGAGCCAAAGGGTCTGGGGGCGCGGTGTCTTCGGGCCCCGGCCCCGGGGGAGCAGC

AGCTCTGGCCCCTGCGGGTCGCGGGCAGCGCTCAGCTGGAGGCGAAGCCCCGCAGCCCCCGGGGGCCCGGGGTGAGGATGGCTCAG - UNI25000 - 

AACTAATGTCTCAGAAGAAATTTGAGGAGATCAAGAAGTCCAATCAAGCTGCAGCCAGAAAGCTGTTGGAGGAGCACTGCAGCTCTTCCTCTGAAGAAGA

AGGGGATGAAGACTTGGAAGGAAAACAGGGGAAAATTGTTGCTAATACATTCACAACATACACTACTCACACAG ATGGAGATATACATGAATTAGAGCG

AACAAAACAGTATCTGAATGAGGCTTTCCAAGCAGGGGCTATGACGTGCCTAATTTGTATTGCTTCAGTGAAGAGAAACCAGGCA GTTTGGAGCTGTTC

AGGATGTTTCTGTATATTCCATATGCCCTGTATTCAGAAGTGGGCTAAAGACAGCCAGTTTCTTGTGTCTTCTGTGACAGACGATGATTTTGGAAAGAAA

GATTATCCCTGGCCATG TCCAAAATGTAGATTTGAATACAAAAGATCAGAAACACCTAGTAGATATTATTGCTACTGTGGAAAAGTAGAAGATCCACCT

TTAGATCCGTGGCTTGTACCTCATTCGTGTGGCCAAGTATGTGAGAGAGAATTTAAACCTTCTTGTGGTCATAAATGCTTGCTGCTCTGCCATCCAG GT

CCCTGCCCTCCTTGTCCAAAGATGGTCACAACCACTTGTTACTGTAAGAAAGCCAAGCCTATCCCTCGCAGGTGCAGTGCCAAGCAGTGGTCCTGTCAGC

TGCCATGTGGGCGAAAGCTGCTTTGTGGACATCATAAGTGTGAAAATCCTTGCCATGCAG GAAACTGTCAGCCTTGTCCAAGAGTTAGTAG
Translation
MDAPWRQVAAGRGRARGRATAVPLSGNGVPFGGAGGGRAKGSGGAVSSGPGPGGAAALAPAGRGQRSAGGEAPQPPGARGEDGSE - UNI25000 - E

LMSQKKFEEIKKSNQAAARKLLEEHCSSSSEEEGDEDLEGKQGKIVANTFTTYTTHTD DGDIHELERTKQYLNEAFQAGAMTCLICIASVKRNQA VWS

CSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDYPWPC CPKCRFEYKRSETPSRYYCYCGKVEDPPLDPWLVPHSCGQVCEREFKPSCGHKCLLLC

HPG GPCPPCPKMVTTTCYCKKAKPIPRRCSAKQWSCQLPCGRKLLCGHHKCENPCHAG GNCQPCPRVS
Transcript ENSMUST00000087216
Sequence
GCTTTTCGGTGCGGTCCACTTCAGCAGTTGGTTCCCGGCCGCGGCCGCGGCCGCACG GGATGGACGCTCCCTGGCGCCAGGTGGCCGCTGGCCGAGGCC

GAGCCCGAGGACGGGCCACCGCAGTGCCCCTCTCAGGAAATGGAGTCCCTTTTGGTGGCGCTGGAGGAGGGCGAGCCAAAGGGTCTGGGGGCGCGGTGTC

TTCGGGCCCCGGCCCCGGGGGAGCAGCAGCTCTGGCCCCTGCGGGTCGCGGGCAGCGCTCAGCTGGAGGCGAAGCCCCGCAGCCCCCGGGGGCCCGGGGT

GAGGATGGCTCAG - UNI25000 - AACTAATGTCTCAGAAGAAATTTGAGGAGATCAAGAAGTCCAATCAAGCTGCAGCCAGAAAGCTGTTGGAGGA

GCACTGCAGCTCTTCCTCTGAAGAAGAAGGGGATGAAGACTTGGAAGGAAAACAGGGGAAAATTGTTGCTAATACATTCACAACATACACTACTCACACA

G ATGGAGATATACATGAATTAGAGCGAACAAAACAGTATCTGAATGAGGCTTTCCAAGCAGGGGCTATGACGTGCCTAATTTGTATTGCTTCAGTGAAG

AGAAACCAGGCA GTTTGGAGCTGTTCAGGATGTTTCTGTATATTCCATATGCCCTGTATTCAGAAGTGGGCTAAAGACAGCCAGTTTCTTGTGTCTTCT

GTGACAGACGATGATTTTGGAAAGAAAGATTATCCCTGGCCATG TCCAAAATGTAGATTTGAATACAAAAGATCAGAAACACCTAGTAGATATTATTGC

TACTGTGGAAAAGTAGAAGATCCACCTTTAGATCCGTGGCTTGTACCTCATTCGTGTGGCCAAGTATGTGAGAGAGAATTTAAACCTTCTTGTGGTCATA

AATGCTTGCTGCTCTGCCATCCAG GTCCCTGCCCTCCTTGTCCAAAGATGGTCACAACCACTTGTTACTGTAAGAAAGCCAAGCCTATCCCTCGCAGGT

GCAGTGCCAAGCAGTGGTCCTGTCAGCTGCCATGTGGGCGAAAGCTGCTTTGTGGACATCATAAGTGTGAAAATCCTTGCCATGCAG GAAACTGTCAGC

CTTGTCCAAGAGTTAGTAGACAAAAATGTGTATGTGGCAAAAAAGTAGCAGAAAGAAGTTGTGCAAGCCCAGTGTGGCATTGTGATCAA GTATGTGGAA

AGACACTGCCATGTGGTAATCATACATGTGAGCAAGTTTGTCATGTTGGTGCTTGTGGAGAGTGTCCTCGATCTGGGAAGAGGTCCTGTCCATGTCAGAA

ATCAA AGTTTTCTTTGCCTTGTACAGAAGATGTACCAACTTGTGGAGACAGCTGTGACAAAATACTTGAATGTGGAATCCATAGGTGTTCACAGCGTTG

CCACCGAGGTCCTTGTGAAACATGCAGACAA GAAGTGGAAAAACAGTGTCGTTGTGGAAAGCACACAAAGCGAATGCCTTGTCACAAGCCTTACCTTTG

TGAAACAAAGTGTGTTAAAATGCGGGACTGTCAAAAGCATCAGTGTAGGAGAAAG TGTTGCCCTGGAAACTGTCCACCTTGTGATCAAAATTGTGGACG

GACTTTAGGATGTAGAAACCATAAGTGTCCGTCTGTCTGCCATAGAG GCAGTTGCTATCCATGTCCAGAAACGGTAGATGTGAAGTGCAATTGTGGTAA

TGCAAAGGTGACAGTACCCTGTGGCCGAGAGCGGACCACAAGGCCACCTAAGTGCAAAGAGCTGTGCAG TCGACCACCAACATGTCATCATGCAAGTCA

AGAAAAACACCGCTGTCACTTTGGCCCATGTCCACCGTGCCATCAGCCTTGCCAAAAAGTTCTGGAGAAGTGTGGGCACTTGTGTCCTGAGTCATGCCAT

GATCAAGCATTAGTAAAGCAGACTGGCAGG CATCAGCCATCAGGCCCTTGGGAGCAGCCAGCTGAGCCTGCATTCATCCAGACGGCCCTGCCTTGCCCT

CCGTGTCAAGTTCCCATCCCTGT GGAATGTCTGGGGAAGCATGAG GTGAGCCCACTACCATGCCATGCTGTAGGACCCTATTCTTGCAAGAGACTTTG

TGGAAGAATGTTGCGCTGTCAGAATCATACATGTATGAAAGAGTGCCACAAAGTTACTGAAGTTGATAGCTCTACTGGCAAAAATAAG GCTGGCCCAGA

ATGCTTTCACTGTGAAGAAGGGTGCTCTAAGTCACGGCCTGCGGGTTGTCCTCACCCTTGTGTTTTGCCATGTCACCCTGGAAAATGCCCTCCTTGTGTC

CAGATGCTTAGAATAAAATGTCACTGCAAGATCACAAGCCTGTATGTGGAATGTAG AAAAATAACCACAGCTGATGTAAGCGAAAAGAACCTCCTCAGT

TGCTGCAAAAACCAGTGCCCCAAAGAG CTTCCTTGTGGCCACAGATGCAAAGAGATGTGCCATCCTGGTGAATGCCCCTTTAATTGCAACCAGAAGGTA

AAACTTAGATGCCCTTGTAAAAGAATAAAACGG GAGTTGCCTTGCAATAAAGTACGTGAAAATCAGGTTTCAGTTGAATGTGATGCAACGTGCAAGGAG

ATGAAGCGGAAAGCGTCTGAG GTTAAAGAAGCAGAAGCCAACGCTGCCCTGGAAGAAGAAAAGCGAAGGCAGCAG GCTGAACTGGAGGCTTTTGAAAA

CAGACTGAAGGGCCGTCGGAAGAAGAGCAGGAAACGCGATGAAGTGGCCGTGGAGCTCTCGCCTTGGCAGAAGTATAAGTCCTACCTCCTTCCCGTGTGT

GCAGTTGTGGTGGCAGTGCTTATGTGGTACATCTTCCATGGTGTGGATTAATGATCCTTTAAATCTCCTGACATACCTCAGACTGGAGTTATATAAATGT

TCAATTTCAGACGTTAGGAAACATGCACTGTAGCATATGACCCACTTCACATTCCTCTCTGTGCCCTTGTCTGGCTGTAGGTAGGACAGAATGCTTAGTG

TCATCTGAGTCAGTACAGTCCCCAGCAGTGAGACGCTGTCTAGAGTCAGCACGACTGCAGCTGTAGAGCAGGCAGCATTGCCCTGTGTGTATGAAGTCCG

TCTTTCTCATCAGATATGTCCATGTTCAAAGACAAAACTGAGCCATATGTGCAGCAGCAGGGGTATTTCTCTGGTCACTTGGTACTTTTCTCGATCATGT

AACTTTCTACTTTTTTAAAGAAATGATTCTATAAAGGAATCTTAAATTCTAACAGGAAGCTTTGTAATTAGATTTCAGGTTAGTTTATCAGAGAGGAATT

TTTATTGGTCATTGAAGCAAATTTTACACTGCATATTCTTGAGAAAATATAAACAAGGGCCAGACTAGGTTCCTCCTAGGAGGTTGGTTTGTTTCTTTTT

TTGGTGCAAGAAGCTTTAACTGATGTTGGCATGTTTTGTAAAACTTGTGTGTATCTTTTTTATGATAATAATAAAGGAAAACTAATATTTATGAGCAATA

TGTGCCGAGCACAGGGCTCGGGGGCTTTATGTACTTGATTCCATTTTTTTTACTGTAATTCTTGATATGTTATAGCTGAAAATAATCCGTTTTGTGAAAT

CAAACTGATAGAGAAATAATAAGCCAAATTACATAGATTTGTAAGTCATTTAAAGTAGTTTTGCAATTTAATTTTATGATTGTTTTCATTAAAAATTTTC

ATACC
Translation
 MDAPWRQVAAGRGRARGRATAVPLSGNGVPFGGAGGGRAKGSGGAVSSGPGPGGAAALAPAGRGQRSAGGEAPQPPGARGEDGSE - UNI25000 - 

ELMSQKKFEEIKKSNQAAARKLLEEHCSSSSEEEGDEDLEGKQGKIVANTFTTYTTHTD DGDIHELERTKQYLNEAFQAGAMTCLICIASVKRNQA VW

SCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDYPWPC CPKCRFEYKRSETPSRYYCYCGKVEDPPLDPWLVPHSCGQVCEREFKPSCGHKCLLL

CHPG GPCPPCPKMVTTTCYCKKAKPIPRRCSAKQWSCQLPCGRKLLCGHHKCENPCHAG GNCQPCPRVSRQKCVCGKKVAERSCASPVWHCDQ VCGK

TLPCGNHTCEQVCHVGACGECPRSGKRSCPCQKSK KFSLPCTEDVPTCGDSCDKILECGIHRCSQRCHRGPCETCRQ EVEKQCRCGKHTKRMPCHKPY

LCETKCVKMRDCQKHQCRRK CCPGNCPPCDQNCGRTLGCRNHKCPSVCHRG GSCYPCPETVDVKCNCGNAKVTVPCGRERTTRPPKCKELCS SRPPT

CHHASQEKHRCHFGPCPPCHQPCQKVLEKCGHLCPESCHDQALVKQTGR HQPSGPWEQPAEPAFIQTALPCPPCQVPIPV VECLGKHE VSPLPCHAV

GPYSCKRLCGRMLRCQNHTCMKECHKVTEVDSSTGKNK AGPECFHCEEGCSKSRPAGCPHPCVLPCHPGKCPPCVQMLRIKCHCKITSLYVECR RKIT

TADVSEKNLLSCCKNQCPKE LPCGHRCKEMCHPGECPFNCNQKVKLRCPCKRIKR ELPCNKVRENQVSVECDATCKEMKRKASE VKEAEANAALEEE

KRRQQ AELEAFENRLKGRRKKSRKRDEVAVELSPWQKYKSYLLPVCAVVVAVLMWYIFHGVD

For any suggestions or comments, please send an email to unitrap@crg.es