Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000072893 (4933439C10Rik)
Chromosomal location
Chr 11: 59319198 - 59324887 (+)
Description
RIKEN cDNA 4933439C10 gene Gene [Source:MGI Symbol;Acc:MGI:1921726]
Human Ortholog
not available
Omim not available
UniTrap UNI37950
Vector Insertion
Chr 11: 59321441 - 59323155
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096104
Sequence
GAAGAGCAGGAGGAGGAGGAAGAGGAGGGTGTTTTAGGCCAGGAGAACTATGGGGTTTCTGTCGCTTCCACTCTTTCAGATTTGCTGGCTCTTTCCTTCG

AAGCCCGGGACAGCAGGCGAGCAGATCCTCACCTTCCAGCTCGGTCTCTCTGGTGTTTTGGCAGAGGCGGCTCCAATGCATGGGCCAGACTCGGTCCCTG

GCCAGGCCAACCCTGTCTCGGGATCCTCTAGAATGCATCAGCTGGGCTTGGGAGCGAAGGGAGACGCCTGGAAGAGAATTGTATTGCTTCATCCCCGAGG

GCACCTATGAGGACGCGGCTCTGGGAGCAGGGATCTGGGCCCGGACGCGGGAAGAGGAGAACAGGGAGCAGGACCCAGGCGCGGGCTGGGGATCAGAGCG

CGGGAAGTGGGGAGCGGGTTCCGGGTTCAGACAGCGGGGCATGGGAAGCCGGGCCACAGTATACTCACCGCTGCGCAGCGTCCCGGTTGGCGGGCCGCGT

AGGCCGGGCCGCCGCGGAAAGGAAAGGCCGGAGCCCTCCGGCTCCCTCCCCTGGGACACTTCCTGCACCGCTCTAGGACCGAGGAGGTCTCCTCATCTCA

GTGGTTCGCTTCCCCGCCTCCTGGCCGAGGTGTACGCGGGGGGGTGACATCCGACACCCCCGGCCCGCCTGGACCGCCCCGCCCCGCCCCGCTCCGTGCT

CTCCCGGCCTGGGCCCGGGGCCCGGGCTTTAGCTTTGTGGGCCTTCCTAGCGGGCTCGGGATGCGCGCGCGCGCCCCGGCGGGACCCGGGCGCTGGGGGC

CAGTTCGCGCGGCCACCAGCCAGGGAGGCCGGCTTGGGGCTTTGCTCTTCTCTGCTCCTCTTGTGTGGGCGCAGGGAAGGGCTGGTCTGGCGGCGCTGGC

GAAATGCCAGAATTGGGAGGAGGAGGGATGAGGTGTAAGGGGATCTCCCAGTGACCATTTGCATCCCGTGTGTGCTGTTGTGCCCCAATCCCTTCCAGCC

GCAATTCCATTTCAAAGCCAACGCTGCCAGAGCCACCCAAATCGGTAGGACTGGAGAAATGCAGACCCAGCGATCCACGGTGCTCGCCGAAGCAGCGGCC

CGCGGCTTCGTGGCATGGAGATGATCTACGATTTCTCTGTTTAAGGAAGACTGTAGCACTCTGGGTCCCTCTGAGCACCAGGATAGTCCTG GTACATGG

TAGGAAGTCACCCTTAAAGAAGGTGGTTTGATAGAGACACCCCACCACCGGCAGACTTCGTGCTTCCGTTTCCTTCTAATAATTGGGACTGGGACAATCT

CTTCCGACTAGTAG AACCTGGAATAGGGACTAATAGACTGGAATCGGAGCACCTGTGTTAAATCACACCCATCAAGGCGCAGTCAGGTGATCTAAGGCC

TGCGTGACCTCTCTGTGCTTCAG - UNI37950 - GGATCGCATTTGGATGCATGTGCAAGCTGTGCTGTAGCCACCTCAGGTCCTGAATCTTTAGGA

CTTGCTGGAGCTCATTGCTGATCTATTTTGGCAG CACGAGTGGTGATGCACACCTGTAATCTCCGCACTCCGGGACTGGGGGCTGGAGGATCAGGTCAT

GGTCTCCTATATAGTGAGCGAGTTTGGGGTCAGCTTGAATGATGAGATACCCAGTCTGAAAATAAAGATGCAAATTGATGAGCTGTGGAGCGACACCCGC

ATGCAGTTGAGTCATCACGCATATACCTACCTCCCCACATCCTTCATGGCCCCCAGGAAGCTCCAGCTGGCTTACAGACTGACTTGTTTTGAGATAGGGT

CTCACTGTGTAGCCCTGACTGGCCTGGAACCCACCGATCTGCTTGCTTCTGCCTCCTGAGCTGCGTGATTAAAAGCATGTGCCACCACACCTGGCTCTAT

TGCATTTATTTATGTATGCGGTGGGAGTGGGTACGCACACACACTTTAGAGGTCAGAGAACAGCTTACCGCGATCAGCTCTCTCTGTCCACCCTGGGGAT

TGAACTCAGGTCGCCTGGCTTGCTAGCCAGTGTCTTTGCCACAGAGCCATCTCAGCAGGTCAGTTTACTCTTTTAACCTGGGAGAGAACATGCGGTGGGC

CTTTGTCCTTCTGTGTTACTATTTCATTTAACTTGATGTCTATCCCTTTGGCTATAAGTGAAGAATTTCCTTACGGATGCCTGAATAAAACTCCATTTTG

T
Translation
MGQTRSLARPTLSRDPLECISWAWERRETPGRELYCFIPEGTYEDAALGAGIWARTREEENREQDPGAGWGSERGKWGAGSGFRQRGMGSRATVYSPLRS

VPVGGPRRPGRRGKERPEPSGSLPWDTSCTALGPRRSPHLSGSLPRLLAEVYAGG   - UNI37950 -  

For any suggestions or comments, please send an email to unitrap@crg.es