Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073102 (Gm1060)
Chromosomal location
Chr 5: 30607914 - 30668993 (+)
Description
gene model 1060, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2685906]
RefSeq_peptide
NP_001028632.1 
UniGene
Mm.389604 Mm.458839 
MGI
MGI:2685906 
Uniprot/SWISSPROT
Q3USS3 
Human Ortholog
ENSG00000157856 (C2orf39)
Omim not available
UniTrap UNI30696
Vector Insertion
Chr 5: 30608133 - 30643988
Public Clones IST11476H3HMF2 (tigm) IST11439H4 (tigm) IST10190F1 (tigm) IST12765A2 (tigm)
IST10930C2 (tigm) IST10262A6 (tigm) IST14462A6 (tigm) IST10779D6 (tigm)
IST14745E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101448
Sequence
GGCTTGTTCCTAGCAACCCGGCTGCTGGTCCAGGCGGAGCTGCCAGTGGGTGGGAGACGCCGCCATGAATCCCTCAGGAACCATTGGGGTCCTAGAGCAG

AATGGGGAAGAACACTTAGCCACCCCGATTCTCGGACCCTCGGTGCATTCGGATAACCCGCAGGAGCGGATCCAGGCCCGGCGCCTGCGCATCGCTGCTC

GTCAGGAAGCCCGAAGGCG - UNI30696 - GGAAGCCCTGGGAGAGTATTTGGACGGGAAGAAGGAGAGTGAGGAGGAGCAGAGCAAGAGCTACAAA

CAGAAAGAAGAGAGCCGCCTG AAACTGACTAAACTCCTGCTCTGCGGGACCGAGTTGGTGACAAATATTCAGGTGGCTGCAGACGTCAGAGAGATCCAC

AGGAGGGTTGAAGAGGAGGAGACAAAGCGGCAGAG ACTGGAGAAGCTGGAGAATGAAGTTAAGACCAGCCAGGATAAATTTGATGAAATCACGGCGAAG

TGGGAGGAGGGCAGACGGAAGCGGATTCCCCAGGAACTGTGGGAGATGCTCAACAGCCAGCAGGTGCACTGTGCTGAGCTCATAGAAGACAAGAACAAGC

TGGCCAACGAGCTGCAGCAG GAGTTAAAAATAAAGGATGACCAGTATGTGAAGGACTTGAAGAAACAGTCGGAAGACATCACCCTGATTCTGGAGAGAA

TGGAGGAGCAGGTGAAGAATGTGATGAAGAACTTCCGCCAGGAGCTGATTCACATCGAG AAAGCCTTTGAGTCAGAACGGCAAGAACTGCTATCCAGCA

ATAAGAAGAAATGGGAGCGAGCCCTGCAGGCTCACAATGCCAAGGAG CTGGAGTACCTCACCAACCGCATGAAGAAGGTGGAGGACTACGAGAAGCAGC

TCAACAAGCAGCGGGTCTGGGACTGTGAGGAGTACAACACAATCAAGATCAAGCTAGAGCAGGATGTGCAG ATTCTTGAGCAACAGCTTCAGCAGATGA

AAGCAACTTACCAGCTAAACCAAGAGAAGCTGGAGTACAACTTTCAGGTCCTGAAGAAGAGAGATGAAGAGAGCACAGTGATCAAGTCCCAGCAGAAGAG

GAAACTGAACCG CCTGCACGATGTCGTCAACAATCTGAGAACAAAATACACCAAGCAGATACGGCAGTTTCAGGATGACAACCAGTCCCTGACCTCCGA

CTACAAACGGCTTGTGACGCAATTCAAGGACCTACAGAAAGCCTTGAG ACACTTCATCATCATCGATGAGGAGAAGTTTCGGGAGATTTGGCTGATGAA

TGAAGCAGAGGCGAAGGAACTGGCACAAAGAGCCTTTGATGTGGACAGGATCATCCATTCCCAGCACCTGGGCTTACCCTGGAATATGCCTGACTTGTGG

TTCCTGAATAACGTGGGGCCGATTTCCCTGCAGCAGCAGAAGTCAGTCACACAAATACTGGAGGAACTGCTGTTGCAGACAG AGGATGAGGCCACAGAG

GCAGCCATGTCGGAAGACGAGGATTACATGGACCTGCCCAATCAAATTTCAGCCAAAACCACCACAAAGGTCCTGATGCTCCTGTGTGATGAGTCG GGT

TTCCTCATAGAGAGCAAACTACTGAGTCTGCTCCACCCCCTGGAGAAGAGTGAATGCTATCTGCTGAGGTTGGACGCCATCTTCTCC GCCCTGGCAATC

GAAGACGAGGATGACTTATACAAGCTGGTAAACTTCTTCCTTCGATACCGAGCCCACCGTCTATCCTCTGCCCAG GCCAGTTCCTCCATTCATAGCAAT

GTGGAGCGTACAAGCCTGATGTCAGCACTAGAGCGTTTGAGTCTGATGTCCCAGACAGACAAGGGAAGCATGGTGTCCAAATCAGATCAGGAGCCCACAG

AGCAGGAGGACGAGCAGGAAGGTGACAACGCAAGCCTCTCGAGCAGGGAGTTGGAAGAGCAGGAGGACCTGTCATCACCCAGGTTCATCCACCCCAATGA

TGTTCTCAAGATTCTGGAGGCCTTTGTCACGGGGCTGAAGAAGCCTAA GGACGCTCAGCCAGTACTGAAATTGAAGAAAGAGACTCGAGATAACTCGAA

GGACACGGAGTACTGGGAATCCCTGGCTGCGGTTATTCCTTTCTTCAAGCAGAACCTCTGGGATGCGCTGTACAAGGCCTTGGAGAAATACTA TCTCGT

GCTGACCGAGAGGGCCAAGCTGCTGATGGAGAATGAGTCTCTGGAGCAGCAGAATGCAGAGATGCAGTCCCTGCTGCAGCAGTATCTCCAGGCCAAG GT

AAACACAGAACTGCAGATCCCACCAACTCAGGGCTTCCGGATGCCCTCAAAATGAAGAAGGATCTTCAAAGCCTGGTGTCATGGAGTCTACACCCATCTC

TTGAGAGCCAGACCCACCCTGGGTTTTTCTGAGCTGGATCTTTTCTGCCAAAATAAGGCATCACTGTTCCCTGAAGTTCTAATAAAGTCTTTTTAAAGCT

TAGGCTGAATGCTGT
Translation
MNPSGTIGVLEQNGEEHLATPILGPSVHSDNPQERIQARRLRIAARQEARRR - UNI30696 - REALGEYLDGKKESEEEQSKSYKQKEESRL KLT

KLLLCGTELVTNIQVAADVREIHRRVEEEETKRQR RLEKLENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNSQQVHCAELIEDKNKLANELQQ E

LKIKDDQYVKDLKKQSEDITLILERMEEQVKNVMKNFRQELIHIE KAFESERQELLSSNKKKWERALQAHNAKE LEYLTNRMKKVEDYEKQLNKQRVW

DCEEYNTIKIKLEQDVQ ILEQQLQQMKATYQLNQEKLEYNFQVLKKRDEESTVIKSQQKRKLNR RLHDVVNNLRTKYTKQIRQFQDDNQSLTSDYKRL

VTQFKDLQKALR RHFIIIDEEKFREIWLMNEAEAKELAQRAFDVDRIIHSQHLGLPWNMPDLWFLNNVGPISLQQQKSVTQILEELLLQTE EDEATEA

AMSEDEDYMDLPNQISAKTTTKVLMLLCDES GFLIESKLLSLLHPLEKSECYLLRLDAIFS ALAIEDEDDLYKLVNFFLRYRAHRLSSAQ ASSSIHS

NVERTSLMSALERLSLMSQTDKGSMVSKSDQEPTEQEDEQEGDNASLSSRELEEQEDLSSPRFIHPNDVLKILEAFVTGLKKPK KDAQPVLKLKKETRD

NSKDTEYWESLAAVIPFFKQNLWDALYKALEKYY YLVLTERAKLLMENESLEQQNAEMQSLLQQYLQAK VNTELQIPPTQGFRMPSK

For any suggestions or comments, please send an email to unitrap@crg.es