Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073160 (AC163041.3)
Chromosomal location
Chr 12: 23962793 - 23979571 (-)
Description
not available
Human Ortholog
not available
Omim not available
UniTrap UNI12600
Vector Insertion
Chr 12: 23962858 - 23963059
Public Clones W136B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101540
Sequence
TTTGCAGAGGACTCGGTAGCTGCAGCTCCCGGAGCACAGCAGACAGAGCTGCAGGCTGCGTGCGCCCCTGCTGCCACCGGACCTGCCGCGGTGGCTCCCG

CGCCCCGCTGCGACTTCCGCACCCGCGCTTATCTTTGCTTAAGTCCCCGAGCGGCGGCGGGGTCGGAGCCCGCGCCTTGGGCGACTGAGGCGGCCGCAGT

TCGCGTCCCGGCGCCCTGGCGATGCCGGACCAGATCTCCGTGTCGGAATTCGTGGCCGAGACCCTTGAGGACTACAAGGCGCCCACGGCCTCTAGCTTCA

CCATGCGCACGGCCCAGTGCCGGGACACCGTGGCGGCCATCGAGGAG GATGCAGTGACTTATGATGATGTACATGTGAACTTCACTGGGGAAGAGTGGA

AGTTGCTGGATCCTTCCCAGAAGAGTCTCTACAAAGATGTGATGCTGGAGACCTACTGGAACCTCACTGTTATAG - UNI12600 - GCTACACTTGG

GAAACCCATCATATTGAAGGACATTGTCAAAGTTCGAGAAGAAATGAAAGGTAA
Translation
MPDQISVSEFVAETLEDYKAPTASSFTMRTAQCRDTVAAIEE DAVTYDDVHVNFTGEEWKLLDPSQKSLYKDVMLETYWNLTVIG - UNI12600 - 

GYTWETHHIEGHCQSSRRNER

For any suggestions or comments, please send an email to unitrap@crg.es