Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073168 (EG432637)
Chromosomal location
Chr 12: 22171708 - 22324391 (-)
Description
predicted gene, EG432637 Gene [Source:MGI Symbol;Acc:MGI:3649058]
UniGene
Mm.460855 
MGI
MGI:3649058 
Uniprot/SPTREMBL
Q8C0H9 
Human Ortholog
not available
Omim not available
UniTrap UNI31316
Vector Insertion
Chr 12: 22212180 - 22324392
Public Clones IST15080H7 (tigm) IST10366E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34281
Vector Insertion
Chr 12: 22186357 - 22212307
Public Clones IST11713G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101547
Sequence
CTTGGTGGCGCGCAGTTCCCACTGCCTGTGCGCGCCCGCGTCTGGGCTCCTTTGCAGAGGACTTGATAGCTGCAGCTCCCGGAGCACAGCGGGCAGAGCT

GCGGGCTGCGCGCGCCCTTGCTGCCACCGGGCGTCCCGCGGTGG - UNI31316 - CTTCCGCGCCCGCGCTTCCCTTTGTTCAAGTCCCGGAGCGGC

GTTGGGGTCCGAGCCCGTGCCCTGGGCGACTGAGGCGGCCGCAGTCCGCGCCCCGGCGCCCTGGCGATGCCAGAACAGATCTCCGTGTCGGAATTCATAG

CCGAGACCCTTGAGGACTACAAGGCGCCCACGGCCTATAGCTTCACCACGCGCACGGCCCAGTGCCGGGACACCATGTCGGCCATCGAGGAG - UNI31

316 - - UNI34281 - GATGCGGTGACTTATGATGATGTGCATGTGAACTTCACTGGGGAAGAGTGGAATTTGCTGGATCCTTCTCAGAAGAGTCTC

TACAAAGATATGATGCTGGAGACCTACTGGAACCTCACTGTTATAG - UNI34281 - GCTACACTTGGGAAAACCATCATATTAAAAGACATTGTCA

AAGTTCAAGAAGAAATGAAAG CCCCTCTTCTCTTCCAGGTTTCCAAAATGCCTTTCTAGGTTAG
Translation
 - UNI31316 - MPEQISVSEFIAETLEDYKAPTAYSFTTRTAQCRDTMSAIEE - UNI31316 - - UNI34281 - DAVTYDDVHVNFTGEEW

NLLDPSQKSLYKDMMLETYWNLTVIG - UNI34281 - GYTWENHHIKRHCQSSRRNES SPSSLPGFQNAFLG
Transcript ENSMUST00000110973
Sequence
ATGCCAGAACAGATCTCCGTGTCGGAATTCATAGCCGAGACCCTTGAGGACTACAAGGCGCCCACGGCCTATAGCTTCACCACGCGCACGGCCCAGTGCC

GGGACACCATGTCGGCCATCGAGGAG - UNI31316 - - UNI34281 - GATGCGGTGACTTATGATGATGTGCATGTGAACTTCACTGGGGAAGA

GTGGAATTTGCTGGATCCTTCTCAGAAGAGTCTCTACAAAGATATGATGCTGGAGACCTACTGGAACCTCACTGTTATAG - UNI34281 - GCTACA

CTTGGGAAAACCATCATATTAAAAGACATTGTCAAAGTTCAAGAAGAAATGAAAG CCCCTCTTCTCTTCCAGGTTTCCAAAATGCCTTTCTAGGTTAGA

ACCCAGGCTGTGATCTGCTGGCCAGACACAACATTTGGCGAACCAGTGGGGGACTGAGAAATGGCAAAGGAATTTTGGAAGAGGCACTGCTGGTTTGGAG

CTCCATGGAATAATTAAAGGATAAAGGAAATTCATACAGGAGAAG GTTCCACCATCTGCCTGCACTTTGACCCCATGGCTGTCAAATCAGAACTCCTGG

AAGCTATTGAATCTGGGGACTTTGAAACACTTTGAGAAAATATGGACAAGGTGGAGCACGGGGTATCCGAGGTCAGTGAAGCTGGTCTGTATACATTGTA

GAAGACATGCATCTGTGAACCCAGAACATGCAGCTCAAAGCATGAATGCTGTGTAGGCTGTAGCCTGAGTGAGGGCAATGATGTCCATGCTACAGATGCC

CCATTCTGGTGGAGGGTGTTGACCAGATGGCCCAGGGAATGTCTCTGTGCCTGTCTCTCAATGTTTCTATGAGTCTAAAACTGCCCTAAAATAAAGTCAG

TTAAAAATACATATGGGACCCAAGGAGCTAAAGGGGTTTGCCACCCCATAGGAGAAACAATATGAACCAACAAGTACCCCCAGAGCTCCCTGGGACTAAA

CCACCAACAAAAAAGAATCCCATGGCTCCAGCTGCATATGTAGCAGACGATGGCCTAGTCAGTCATCAATGGGAAGAAAGGCCGTTGGTCTTGTGATGGT

GCTATGCCCTAGTATAGGGGAATGCCTGGGCCAGGAATCAGGAGTGTGTGGGTTGGGGAGCATAGGAAGGGGGGCGAGTTATAGGTGATTTTCAAAGGAG

AAACAGGAAAGGGGATGTTTGAAATGTAAAATAATGAAAATATCTAATAAAATATACATATGTGGACTGGTGGTGTGGCTCCATGCTTAAGAGTTCTTAC

TGTTCTTTGAGCAGACTCTAGTTCATTTCCTCCCTTTTTGAGAGGCTCACAATCACTGATAATTCCAGCTCTGGGGGATCGGATGCCCTCTTCTGGCCTC

CATGGGCACCTGCACTAGCGTGCATATTCCCAACCTAACGTGCCCATATCTGTTAGGGAAGTACATGGCTTTTCTAGTCCAGATCTTGGATTTTTGGTCT

GAGTCTAAATTCAGGGGTAGTCCTTTGTAAAGCACTGAGTATTGAGTGCCTGCTTTGTTTATAGCTACTGGTTAGGCACTGATGCAAGGTAATGAATGAA

GTGATGCCCTCTTGACTTCATGGTGTCCAGTCAACCTGGCTGGGTGGGAAGAGGGCAGACACCCAGTCTCCACCACTATCCCTAGTCTGCAGAGCAAGGG

AAGTCCTAGGTCCTCCTGCTCTTTAGAACAGACTCTGGGGCAAACCAGTGCTTTGTTCAGTAAGAACATTGCAAGTATGATCATTGCTGTGAATGGAGAG

ACTGCACCATAAGGGGAAACAGAGACAGTGCTGTAGCCTAGGAAGAGAAGTTGTGCTCGGGTGACAGGACTTTCCTGTCCCATTCTGACTGCCACTTAGC

TCTTGAGTCAATTACTAGCCTCCCTGTGAGCCCCATCTTCCATCTCGAGGAAATGGAGGTAACACTGGGCCTCCCTCCTTGGTCTGTCCTGAGGATCTCA

GGGGACAATGACAGCTTTCAGTGAGGTACAAGACTATTTAGGAACAGTCCCATAATACTGTTCACTGAGAAGAGGCCTCCAGTCCCCATGTTGGGAACAG

AAGTAGGAAAGAGATGGCCTTCTGAGCTGGCTCTACAAGGGTGGCTAAGTTATATTCATCATGCTGACTGTGTGTATCTTTGACCAGATTGGTGATGGTA

GTGTGCTGTCTGAGTTGGGATATATTTTTACTCCATGTGTACATTTTCTTTGTGCCATTTTCTGAGCCAGCGAAGCACGTCTGGGCAGTATGGGCTTTGA

GGAAAAGGCCTGGTTCAGGTCACTCCCAATAAAATCCAGAGCAGGACCTTGGGTGCTCTTTGAGCCTTCCCAAGACCAGCCAGGATACTCTATCAAGCAT

CCTAATGACCAGAAAAGAAAAAGGTCTAGGAGCCACACACAGCTGCATCTGGATAGCCCAGTTACCTGAATCCATAGAGCAATGGCCATGACCATCACCC

ACATTGGCTTTGTGACAATGTTATTCCAGCTGAGGGTCACCAGTATCTCACCAGGCTTCTGTTAATGGGGGATCATAGGAATTAAACACACACACACACA

CACACACAGAG
Translation
MPEQISVSEFIAETLEDYKAPTAYSFTTRTAQCRDTMSAIEE - UNI31316 - - UNI34281 - DAVTYDDVHVNFTGEEWNLLDPSQKSLYKDM

MLETYWNLTVIG - UNI34281 - GYTWENHHIKRHCQSSRRNES SPSSLPGFQNAFLG 

For any suggestions or comments, please send an email to unitrap@crg.es