Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073207 (6330534C20Rik)
Chromosomal location
Chr X: 50144377 - 50152645 (+)
Description
RIKEN cDNA 6330534C20 gene Gene [Source:MGI Symbol;Acc:MGI:3588225]
RefSeq_dna
NM_001034059 
RefSeq_peptide
NP_001029231.1 
UniGene
Mm.23411 
MGI
MGI:3588225 
Uniprot/SWISSPROT
Q3UYG1 
Human Ortholog
ENSG00000203952 (AC004409.1)
Omim not available
UniTrap UNI16635
Vector Insertion
Chr X: 50144503 - 50151235
Public Clones B41 (vanderbilt) IST14613D12 (tigm) IST13764F4 (tigm) IST10923D7 (tigm)
IST14974A10 (tigm) IST10967H11 (tigm) IST10230F8 (tigm) IST14739B7 (tigm)
IST10976G3 (tigm) IST14645B11 (tigm) IST10278H11 (tigm) IST14996F3 (tigm)
IST14355A11 (tigm) IST14141E7 (tigm)
Private Clones OST456571 (lexicon) OST435014 (lexicon) OST410971 (lexicon) OST281275 (lexicon)
OST252683 (lexicon) OST217610 (lexicon) OST208996 (lexicon) OST189493 (lexicon)
OST167116 (lexicon) OST105474 (lexicon) OST93358 (lexicon) OST53263 (lexicon)
OST20647 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101588
Sequence
GCTCTGCCCCGGGCCAGCCTGGCCGGGTCGTGGTGGCTAGCACTGAACAAGGGGCTGCCTCCTGTCGGTAGTGACCGGCTTCGGGGAAGAGTGGACAGGG

CTCTCCAACCGCACCCGCGCTTCCAG - UNI16635 - GAAATCAAACAGGTACCCAGGAAAATGGATGCTCGAAGAAAGCACTGGAAAGACAATACG

TTCACTCCTTTTTTAAACGAGCACGATTTTCAGGAAGCTGCTGCTCCACCCCAGCCTCTCTCTGAACAGTCATCAGCAGACAACCACAAGAGGATGGGGA

GAGTGTCTAACTTCTCCGTTAGGAACACTCAAGAAGGAAATAAATTCAAGAGGAAAGACTATTCTTCCCAGATAGCAGAAGGAGAACAAGATTCAAATTT

AAGAGAGAGAAGAATGAACGTGTCAAAGAATGATGCAAATACCAATTCTGCCTTCTGGGACTCTCTTCATTTGGATGATGCAACGAAGGAAAGTTCACAC

AGAAGGGAGAGCGCCTCCGCGTGGAATAAGAAGAAATTGCCGGCCGCCACACAAGTCACCAGGAAGAAATGGACAGAAGCAATGCCTCCAAAACTCCGCC

TACACCTTCTGAACGAAGAGCTGGGAGAACTCAGCCTGAAATGCCGGGAGATTGAACGGGACTTTGAAAACGCCGAAAAAGAACTTTTGAACTTTAGAAA

GGAAGCCTCCGTGAAAGCTGTCAATTTTCAAGAACCAGGGACAGGTGCTTCCAAGAAAGACCGGGAACTGCAAGCTTTAAAAAACGACCTGTCTGAAAAA

GCGACAAACGTAAAAAACTTAACTGAAGAGCTCCAGCAAGCCAAAGAAGTCATGTACAGGTTGAGCCTAGAGAACAGGAACTTGAAAGACGCTGTCAGGA

AACTGAAGCATCAAACTGAACTAAATACTGCGCTCCTCAGAGAAGAAATGAAGTTGTTTTACGAGCTGGAGATGGAAAAGATCCGCTTGGAGCTGGGTGC

CATCAAGAATGAGCTGAGAGTCGAGAAGACCCTAAGGGTGAAGAACAGCAGGGCTCTGGAGGTGCTTGGAAGACACGTTGCTTCAGTGGTAAGGTCGTCA

AATCCTGCTGACCACTTTACTGGGAATATTTTTTAAACTTAAAAAACAAAAAGCCTTTCACTGGGAACGCTATTGAGCCAAATCAATATTTATCGTACTA

TATATATTTGTGTACTGCTAAAATGTATTTGAAAGCGTGTAATCTTTACTTCTGGTGAATCAGAGCACCTACCAATTATGCAGATGCTGACTTCAAAGCA

GCTGTTTCTCTTTCTGATGAAGGCATTGTGAGACTCTGAATGAGAAGTTCTAAAATCTCTTTTGTATGGGATATATATATATATATATATATACACAAAA

CAACCAAACAACCCAAACTGATTCACTAGATCGTAGATGACTGAATGAGCAGCACTGTGTGACCTTGTTAGCCATGTCCTTGGCACATCAATGTTTTCCC

ATCTGTGGTAATCAATGTGAACAATAAAAAATCTGTTTACATGTATAAGC
Translation
 - UNI16635 - MDARRKHWKDNTFTPFLNEHDFQEAAAPPQPLSEQSSADNHKRMGRVSNFSVRNTQEGNKFKRKDYSSQIAEGEQDSNLRERRMNV

SKNDANTNSAFWDSLHLDDATKESSHRRESASAWNKKKLPAATQVTRKKWTEAMPPKLRLHLLNEELGELSLKCREIERDFENAEKELLNFRKEASVKAV

NFQEPGTGASKKDRELQALKNDLSEKATNVKNLTEELQQAKEVMYRLSLENRNLKDAVRKLKHQTELNTALLREEMKLFYELEMEKIRLELGAIKNELRV

EKTLRVKNSRALEVLGRHVASVVRSSNPADHFTGNIF

For any suggestions or comments, please send an email to unitrap@crg.es