Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073236 (2500004C02Rik)
Chromosomal location
Chr 2: 153166893 - 153171457 (-)
Description
RIKEN cDNA 2500004C02 gene Gene [Source:MGI Symbol;Acc:MGI:1919576]
UniGene
Mm.400102 
MGI
MGI:1919576 
Uniprot/SPTREMBL
A2AMC7 
Human Ortholog
not available
Omim not available
UniTrap UNI18914
Vector Insertion
Chr 2: 153168601 - 153171356
Public Clones (ggtc) CMHD-GT_405H7-3 (cmhd) CMHD-GT_378C2-3 (cmhd) CMHD-GT_479G6-3 (cmhd)
CMHD-GT_394C10-3 (cmhd) CMHD-GT_384C5-3 (cmhd) IST11970F3 (tigm) IST10472A5 (tigm)
Private Clones OST411064 (lexicon) OST397378 (lexicon) OST383623 (lexicon) OST382227 (lexicon)
OST346362 (lexicon) OST296660 (lexicon) OST259475 (lexicon) OST240084 (lexicon)
OST230371 (lexicon) OST174083 (lexicon) OST156064 (lexicon) OST155969 (lexicon)
OST42211 (lexicon) OST34537 (lexicon) OST28593 (lexicon) OST22250 (lexicon)
OST20330 (lexicon) OST19298 (lexicon) OST13531 (lexicon) OST8378 (lexicon)
OST1390 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109791
Sequence
AGAAAATGGCTGCCTCAAGTGCTTGGACCACATTTCCCGGAGTGCCCCGGGCTCCTGTTTTCCGCCCACTTTCTTCCGTACCCCGCTGCGCTCCAAGCAC

G - UNI18914 - GTGACCTTTGAAAGTTAACAGGGGTGCCATGGGCTGAGTAAGATAAACGGAACTGCTGTTCAACCCCGCCCAGTCTGGGGATGAG

TCATTGTTTTCAAATTTATGAACAAAGCACACAAATTAAGAATAATACAAGCAAGAAACAGCAGAGAGACACAAAAGGACATAGAATCCCTGATCCTCAC

TGTGATCTGGTAACACTAGTTCTAGGGCTGGAGAGAGAGATGCTCAGGGCAAGTGCTCTTACAGAGAACATGAGTTCAATTCCCAGAACCCACATGGTAC

CTCACAACTGCCTATTTCATACATGTGGGGCAGAACACCGATACACATACTTTTTTTTTTAAGAATTGAAAAAAAAAAAAAATTGGTTCTGGACTCCAGT

GGGTCTGAGTTTGAAACCGTAGCTGTTCTCCAGTTGTGTGGCCTTGAATAAGTTATGCAACTTCATCAACCAAGCACTGTCATTGGACAGCAGAGAATAT

GACAAAAGTCAACGGGCGATCTGAACAAGTGGCACATGCTTGCATACTTGGATGACACAGTTCGAGAAGCACTTGAACCCTGAAGTTTACAAACAGCCTC

GATAACACAGGAAGACCCCATCTCAGAAGAATAGATGAGATCACTATTTCTCAGCTTCAGCATTGCAGATGATCAGCTAATGTGGAACTCTCCAGCCCCT

TTGCACATTGCATTTCTTTGCATGGCTTTTGGTTGGTAACTATACATTTGGCATCTGTTTGGATTTTTTTTCTGTATACCCCAAATGCCAGCCATAGTCT

TGGGCATATAGTAGGCAGTCAAACTGTTGGTGTATGAACCATTCTCAGTAATTCTTTTGTTGTAGACAGTCTCTGAGGAATTATCCCCTATTGAATGGTC

TCATAACAGTTTTGGAAAGCGCTCATGTAGGGAAAAAACTAAGATAAGATTTTACCCAGGAAGGTCTCCACAAGTGCAAAGTAGAGACTTCAGGACATTC

CCAGTCTCGTTGTGTTGCCAAATCTACCCTCACAATGCATGACTTAACTCATAAATCCTGGGCCAGTCACAGTTTTTTAAATTCTACTCTTTAGTCTCCC

ATGCTCTGGAGAAGGTATTTAAATTGCCAAAATGTTTAACAATAGTTCTCTAGGTTTTATAAGACTAGTTAGTTTACTGGTAATTTTTCTGTACAAAAAA

ATTGCATTGGGCTGGTGAGATGGCTCAGTGGGTAAGAGCACCCAACTGCTCTTCTGAAGGTCTGAAGTTCAAATCCCAGCAACCACATGGTGGCTCACAA

CCATCCATAATGAGATCTAACTCCCTCTTCTGGAGTGTCTGAAGACAACTACAGTGTACTTACATATAATAAAAATAAATAAATCTTTAAAAAAAATACT

TGCTAAAAAATTGCATTATTTTAACTTTAAAAGTTTTTACTTCAAAAACAATAAAACATTTAAAGTGGCAGTTATAATAGTGATATAGTAAATATATTTT

TTCTGTCACATCTTCCAAATCTAGAATGTGTGCTCCATTATGATGTAAAAGTAAAGTTTCATTAATATCAGCCAATAGTGGAAGAACATCTTTAATAATA

GATTCATCTTCCCACTTTGGTGGACCTGTAGAGTGGCCTCAAAGGGAGACTTAAGCTGGTTTTTATCAAAATTTTGGGACATGACATTTCCTGACAGAAT

AAAGTTTTCTGGTAGAAATTTCC
Translation
 - UNI18914 - MSHCFQIYEQSTQIKNNTSKKQQRDTKGHRIPDPHCDLVTLVLGLEREMLRASALTENMSSIPRTHMVPHNCLFHTCGAEHRYTYF

FF

For any suggestions or comments, please send an email to unitrap@crg.es