Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073403 (CT030728.6-202)
Chromosomal location
Chr 17: 36278703 - 36282868 (-)
Description
not available
Human Ortholog
not available
Omim not available
UniTrap UNI33820
Vector Insertion
Chr 17: 36282332 - 36282869
Public Clones IST14285D5 (tigm) IST10434F3 (tigm) IST12903B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32298
Vector Insertion
Chr 17: 36281856 - 36282603
Public Clones IST11175D6 (tigm) IST10316G6 (tigm) IST12097A4 (tigm) IST10419A3 (tigm)
IST12368B7 (tigm) IST10927C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064686
Sequence
ATGGCGCAGCGAATGCTGCTCCTGCTGCTGGCGGCCGCCCTGACCCTGATCGAGACCCGCGCGG - UNI32298 - - UNI33820 - GCTCACACT

CGATGCGGTATTTCGAGACCGCCTTGTCCCGCCCTGGCCTCCGGGAACCCCGATTCATCTCTGTCGGCTACGTGGACGACACGCAGTTCGTGCGCTTCGA

CGGCGACGCGGAGAATCCGAGGTATGAGCCGCGGGCTCCATGGATGGAGCACGAGGGGCGGGAGTATTGGGAGCGGGAGACACAGATCGCCAAGCGCAAT

GAGCAGAGTTTCCGAGGGAGCCTGAGGACCGCGCAGCGCTACTACAACCAGAGTGAAGGCG - UNI32298 - - UNI33820 - GCCTTCACACGT

TCCAGCTGTTGTTCGGCTGTGACGTGGGGTCGGACGGGCGCCTCCTCCGCGGATACCTACAGTTCGCTTATGATGGCCGAGATTACATCGCCCTGAACGA

AGACTTGAACACGTGGACGGCGGCGGACCTGGCAGCGCTGATCACCCGACGCAAGTGGGAGCAGGCTGGTGCTGCAGAGCATTACAAGGCCTACCTAGAG

GGCGAGTGCGTGGAGTCGCTCCGCAGATACCTGCAGCTCGGGAAGGAGACGCTGCTGCGCACAG - UNI32298 - ATCCCCCAAAAGCCCATGTGAC

CCATCACCCCAGATCTGAAGGTGATGTCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCTGACATCACCCTGACCTGGCAGTTGAATGGGGAGGAG

CTGACCCAGGACATAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTCTTGGGAAGGAGCAGAATT

ACACATGCCATGTGGAACATGAGGGGCTGCCTGAGCACCTCACCCTGAGATGGG AGCCTCCTCCATCCACGGACTCCAACATGGTAATCAT GGCTGTT

CTTGTTGTCCTTGGAGCTGTGATCATCATTGGAGCTATGGTATCTTTTGTGTTGAAGAGCAGGAGAACAATAG GTGGAAAAGGAGGGGACTATGCTCCG

GCTGGAG GAAGCAAAGGTGGCCAGGGCTCTGACTTGTTTCTGGGGGCCTTCAAAG CTATCCTTCCTGGTCCTGCAGGCACTAGGGGACATCTGCATCC

TGACAGCTCCATGCTGCCCTGAGCTGCAGCTCCTCACTTCCACACTGAGAATAAGAATCTGGAGAGATGGCTCAGCAGTTAAGAGAACTGACTGCTCTTT

CAGAGGTCCTGAGTTCATTCCAAGCACTCACATGGTAGCTCACAACCATCTGTAATGGAATCCCATGTACCCTTATAGTATATGTCTGGAGCTAGGTGCA

GTATATTTATATAATAAATAAATAAATCTTTTT
Translation
MAQRMLLLLLAAALTLIETRAG - UNI32298 - - UNI33820 - GSHSMRYFETALSRPGLREPRFISVGYVDDTQFVRFDGDAENPRYEPRAPW

MEHEGREYWERETQIAKRNEQSFRGSLRTAQRYYNQSEGG - UNI32298 - - UNI33820 - GLHTFQLLFGCDVGSDGRLLRGYLQFAYDGRDY

IALNEDLNTWTAADLAALITRRKWEQAGAAEHYKAYLEGECVESLRRYLQLGKETLLRTD - UNI32298 - DPPKAHVTHHPRSEGDVTLRCWALGF

YPADITLTWQLNGEELTQDIELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVEHEGLPEHLTLRWE EPPPSTDSNMVIM MAVLVVLGAVIIIGAMVS

FVLKSRRTIG GGKGGDYAPAGG GSKGGQGSDLFLGAFKA AILPGPAGTRGHLHPDSSMLP

For any suggestions or comments, please send an email to unitrap@crg.es