Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073455 (9030025P20Rik)
Chromosomal location
Chr 17: 15147213 - 15159904 (+)
Description
RIKEN cDNA 9030025P20 gene Gene [Source:MGI Symbol;Acc:MGI:3583895]
RefSeq_peptide
NP_001116844.1 
UniGene
Mm.470319 
MGI
MGI:3583895 
Uniprot/SPTREMBL
Q8BN17 Q8C9C8 Q6P064 
Human Ortholog
ENSG00000130023 (C6orf70)
Omim not available
UniTrap UNI25636
Vector Insertion
Chr 17: 15155929 - 15156033
Public Clones not available
Private Clones OST172850 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32103
Vector Insertion
Chr 17: 15157299 - 15158878
Public Clones IST14747E8 (tigm) IST11504B5 (tigm) IST10296D3 (tigm) IST11675C5 (tigm)
IST12441D7 (tigm) IST10876F1 (tigm) IST14873H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097396
Sequence
GGAGCGCTGCGTCCCATCCCTTATTCTGAGTTGCTGTTCCAGGAGCCCGTCCTGGCAGGCCCGCAGCGCAATACTGTCACGCGATAGT ATTTTACCAGG

GGATTCCATGACCACATGCCTTTCTCCTTTAGTGCATGACTTGATTTGTAACCTTGGGTTTGAACTCAAAGAAATTTGTGATATCAATAGCATTGTAACT

CAAAATGGTGAAGTACGATGGAAAGCAATTACTGACCGTGTGAGATATGAAGAATTAG GGCGAAGTCTGGACTACAGGAGAAGTGTGCAGCAGCTGGGT

CCGGTGTGTGAGGCCATCCACCTACACATCTCAGCTCTGACCAGGGCTCAGTTTGAAATTCAGTATTCGCCTTGGTACCAGTGGACAACTTATCCAGAG 

TTGTTTCTTGAGATACTTGATGCCTTGCAAAGCTCGCAGCCTGCTGCCGTCTCCCTCGGCGTGATGAAACTAGCTTCCTGTCTGGAGCGAGCCCTCGGCG

AC GTATTTTTACTGGTTGGGAAAGAGTGCCCCTTTCTCCTAAGAGATCTTCTTGCATCTGCAGAGCTTGCACAAGTCTTTGGACATGCTGTG ATGGAC

ATACTAAAAGTCTTCATCGGGTCTCCCTGCGGACTCAACCTGAGAAACGTCTTGTGGCATGGCTTTGCTTCCCCTCAAGATATTCCTCCAAA GTGTGAC

TTATGAGGTACTGTCAGCATTAGAGACAGTGATGACAAAATCCAACTTCCTATTAAAAATCATGTTGCCATATTGGGAAATGGCAGTGAGCAAGTTCAAG

TCGCACAG - UNI25636 - GTTTGCCGACTGCACCATGTTGTTGCTGTCACAGCTAGAAGCTGGACTCAGGAGACTGTTTGCTGCAGTTAACAAGTG

TCCTGATAGACTGCTCACAGCCGAGGTACAAGTGTTTCTGTTACTCACTCAAACTGCAATTACTATGTTGACAATTGTCTGTGGCTATTTAAAAGTTTTA

AGGGCTGGAGATGCAGAATGTTAG
Translation
     MALLPLKIFLQS SVTYEVLSALETVMTKSNFLLKIMLPYWEMAVSKFKSHR - UNI25636 - RFADCTMLLLSQLEAGLRRLFAAVNKCPD

RLLTAEVQVFLLLTQTAITMLTIVCGYLKVLRAGDAEC
Transcript ENSMUST00000097397
Sequence
GACCCGAGCCGGAAGCGATGGAG ATTTTACCAGGGGATTCCATGACCACATGCCTTTCTCCTTTAGTGCATGACTTGATTTGTAACCTTGGGTTTGAAC

TCAAAGAAATTTGTGATATCAATAGCATTGTAACTCAAAATGGTGAAGTACGATGGAAAGCAATTACTGACCGTGTGAGATATGAAGAATTAG GGCGAA

GTCTGGACTACAGGAGAAGTGTGCAGCAGCTGGGTCCGGTGTGTGAGGCCATCCACCTACACATCTCAGCTCTGACCAGGGCTCAGTTTGAAATTCAGTA

TTCGCCTTGGTACCAGTGGACAACTTATCCAGAG TTGTTTCTTGAGATACTTGATGCCTTGCAAAGCTCGCAGCCTGCTGCCGTCTCCCTCGGCGTGAT

GAAACTAGCTTCCTGTCTGGAGCGAGCCCTCGGCGAC GTATTTTTACTGGTTGGGAAAGAGTGCCCCTTTCTCCTAAGAGATCTTCTTGCATCTGCAGA

GCTTGCACAAGTCTTTGGACATGCTGTG AATATTCTAGAGGAACTGTAA
Translation
ME ILPGDSMTTCLSPLVHDLICNLGFELKEICDINSIVTQNGEVRWKAITDRVRYEELG GRSLDYRRSVQQLGPVCEAIHLHISALTRAQFEIQYSPW

YQWTTYPE LFLEILDALQSSQPAAVSLGVMKLASCLERALGD VFLLVGKECPFLLRDLLASAELAQVFGHAV NILEEL
Transcript ENSMUST00000061688
Sequence
GACCCGAGCCGGAAGCGATGGAG ATTTTACCAGGGGATTCCATGACCACATGCCTTTCTCCTTTAGTGCATGACTTGATTTGTAACCTTGGGTTTGAAC

TCAAAGAAATTTGTGATATCAATAGCATTGTAACTCAAAATGGTGAAGTACGATGGAAAGCAATTACTGACCGTGTGAGATATGAAGAATTAG GGCGAA

GTCTGGACTACAGGAGAAGTGTGCAGCAGCTGGGTCCGGTGTGTGAGGCCATCCACCTACACATCTCAGCTCTGACCAGGGCTCAGTTTGAAATTCAGTA

TTCGCCTTGGTACCAGTGGACAACTTATCCAGAG TTGTTTCTTGAGATACTTGATGCCTTGCAAAGCTCGCAGCCTGCTGCCGTCTCCCTCGGCGTGAT

GAAACTAGCTTCCTGTCTGGAGCGAGCCCTCGGCGAC GTATTTTTACTGGTTGGGAAAGAGTGCCCCTTTCTCCTAAGAGATCTTCTTGCATCTGCAGA

GCTTGCACAAGTCTTTGGACATGCTGTG ATGGACATACTAAAAGTCTTCATCGGGTCTCCCTGCGGACTCAACCTGAGAAACGTCTTGTGGCATGGCTT

TGCTTCCCCTCAAGATATTCCTCCAAA ATACTGTTCAGCCATGTTGCTGTTGACGGCAGGACTGGGCCAGTTACTGAAGAGTTACCTTCACCACACAAA

GGTCACCTTGGCACATCGACCTTTTGTAACACTCACAAACTTAGAGGATGTGATTGTTTTTCCTG GTGTGACTTATGAGGTACTGTCAGCATTAGAGAC

AGTGATGACAAAATCCAACTTCCTATTAAAAATCATGTTGCCATATTGGGAAATGGCAGTGAGCAAGTTCAAGTCGCACAG - UNI25636 - GTTTG

CCGACTGCACCATGTTGTTGCTGTCACAGCTAGAAGCTGGACTCAGGAGACTGTTTGCTGCAGTTAACAAGTGTCCTGATAGACTGCTCACAGCCGAG -

 UNI25636 - TCAACAATTCTGTATACCACGTTTGATGAA ATACTGGCAAAACACATGAGTGATGGTAGCATGAACCAGCTTCCTTGTTTCCTTGGA

GAGCCTGCCATG - UNI32103 - GAATTCTTGTGGGATTTCCTGAACTATCAGGAGGGTCCTCGTATCCGGGATCATTTAAGCCATGGGGAGATCAA

CATATGTGAATTTCCAGAAGAGGCCGCAGGCCAGCTGCTCACATTCTCCCTGGTGCTGCTGCTCAGATTCACTGAGAAGGGGACAGTGTCAGAACTGAAG

GTACCACAGAGGGAGGGAGGAGGGTGGCTGGCAGAATGTACTACCACCAGCAAGGGAAGAGCATGTCTTATTTCTCAAATTTGATTTATCTTAATTTGAG

TTACAATACCCTGTCAGAATATATGCATGTGTACATTCTCTAAAAGTCTGGGTTCTGAAGCTGAAATAATTTGTCTTTGAAATGCCTTTTTGGCTCTGTT

CTTAATAGCAGTGTCAGTGTTAAAAACCAAAGAGTAAGTTACGCAACATGGTTGGCCAAGTGTGGGAGACGCCCACAGTGCCTGCTAAACTGATGGAGCA

GGATAGTTATAGTTTTGAAACTAATGATTTTGTTGTTTTAAAGTAAATAGCTTCAGCTGTAGTAGTGTAGGTGGGACTTTTGTTTTCAGTTTAGATGCAT

GACAGTTAAAAGAACCTAGTGGGGAAACCCCACTCAATTCCCAATTCGGTGTGCACCCAAGAATCACGAACAGAACAGAATGCCTTGATGTAAAAACATG

AGGTAGTTTAATGGCGGAGCTCTGGGTCGAAATGTATCTCACACAGGAGACAGTGGTTTCGACCACAAGGCTTGGAAACTAGGGGTTTTTAAAGAAAAGG

GGCTGGGGCTGGGGGAGGAATTGGCGCGGTTTCACATGATTGGTCCATTTAAACACCAGCAGACTGTACTTAACTTAGGTCAGAAGGGGGGGAGATAGGG

AGGCGCGGGGCCAGCCCAGACAGGTATGGCCAAGCAGCCTCAGGAATGTCTTAACGACGGGCCTGCCCGGGCATGTTCTGCTATGTTCTCAGCCCTAGGT

TTCAAAGCTCACAAACAACTCTTTGGGCTATTTGACATAAATTACATGAATC
Translation
ME ILPGDSMTTCLSPLVHDLICNLGFELKEICDINSIVTQNGEVRWKAITDRVRYEELG GRSLDYRRSVQQLGPVCEAIHLHISALTRAQFEIQYSPW

YQWTTYPE LFLEILDALQSSQPAAVSLGVMKLASCLERALGD VFLLVGKECPFLLRDLLASAELAQVFGHAV MDILKVFIGSPCGLNLRNVLWHGFA

SPQDIPPK KYCSAMLLLTAGLGQLLKSYLHHTKVTLAHRPFVTLTNLEDVIVFPG GVTYEVLSALETVMTKSNFLLKIMLPYWEMAVSKFKSHR - U

NI25636 - RFADCTMLLLSQLEAGLRRLFAAVNKCPDRLLTAE - UNI25636 - STILYTTFDE ILAKHMSDGSMNQLPCFLGEPAM - UNI3

2103 - EFLWDFLNYQEGPRIRDHLSHGEINICEFPEEAAGQLLTFSLVLLLRFTEKGTVSELKVPQREGGGWLAECTTTSKGRACLISQI

For any suggestions or comments, please send an email to unitrap@crg.es