Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073633 (Fbxo36)
Chromosomal location
Chr 1: 84836420 - 84897059 (+)
Description
F-box protein 36 Gene [Source:MGI (curated);Acc:Fbxo36-001]
RefSeq_dna
NM_025386 
RefSeq_peptide
NP_079662.1 
MGI
MGI:1289192 
Uniprot/SWISSPROT
Q9CQ24 
Human Ortholog
ENSG00000153832 (FBXO36)
Omim not available
UniTrap UNI13061
Vector Insertion
Chr 1: 84836544 - 84877666
Public Clones (sanger) E115A12 (ggtc) D135C10 (ggtc) E072A06 (ggtc) D159G06 (ggtc)
D087G01 (ggtc) CMHD-GT_498C11-3 (cmhd) CMHD-GT_171C3-3S (cmhd) CMHD-GT_260F5-3 (cmhd)
CMHD-GT_513E8-3 (cmhd) CMHD-GT_403H9-3 (cmhd) CMHD-GT_443H9-3 (cmhd) CMHD-GT_343A12-3 (cmhd)
CMHD-GT_540F2-5S (cmhd) CMHD-GT_180G7-3 (cmhd) CMHD-GT_513C5-3 (cmhd) CMHD-GT_424B2-3 (cmhd)
CMHD-GT_522A10-5S (cmhd) CMHD-GT_304E3-3 (cmhd) CMHD-GT_234D5-3 (cmhd) FHCRC-GT-S11-4C1 (fhcrc)
FHCRC-GT-S23-2B1 (fhcrc) PST12543-NL (escells) IST14162C12 (tigm) IST14121B3 (tigm)
IST12668G4 (tigm) IST13531B2 (tigm) IST13503F5 (tigm) IST10368H12 (tigm)
IST10226E5 (tigm) IST10834H3 (tigm) IST11102D8 (tigm) IST12461F3 (tigm)
IST10934A5 (tigm) IST13360A9 (tigm) IST14516F7 (tigm) IST13087C3 (tigm)
IST10246B9 (tigm) IST10572E7 (tigm) IST10811A11 (tigm) IST10356E12 (tigm)
IST13158D6 (tigm) IST14278A11 (tigm) IST13293C3 (tigm) IST12129D1 (tigm)
IST11547B12 (tigm) IST10839C8 (tigm) IST14255B11 (tigm) IST14691F2 (tigm)
IST14791H11 (tigm) IST10316D4 (tigm) IST10871B10 (tigm) IST10315E10 (tigm)
IST12537E9 (tigm) IST11051G12 (tigm) IST12384D10 (tigm) IST12943E10 (tigm)
IST14021C1 (tigm) IST13706E10 (tigm) IST11494C1 (tigm) IST14305E12 (tigm)
IST11468A4 (tigm) IST12788G1 (tigm) IST12083H9 (tigm) IST14179B10 (tigm)
IST14913B9 (tigm) IST15056B12 (tigm) IST13260A12 (tigm) IST15086F10 (tigm)
IST14262H5 (tigm) IST13857H8 (tigm) IST10342G11 (tigm) IST13681E10 (tigm)
IST14796E9 (tigm) IST12146C4 (tigm) IST12889D6 (tigm) IST10305B11 (tigm)
IST12258A7 (tigm) IST14900F3 (tigm) IST11356E12 (tigm) IST10047B4 (tigm)
IST14347A5 (tigm) IST11816A6 (tigm) IST14332A7 (tigm) IST13257F6 (tigm)
IST14798H2 (tigm) IST13119C11 (tigm) IST11078F6 (tigm) IST12384C10 (tigm)
IST14210H5 (tigm) IST12237C7 (tigm) IST11868B9 (tigm) IST10961H5 (tigm)
IST12760A10 (tigm) IST13342E4 (tigm) IST11078H5 (tigm) IST13644G10 (tigm)
IST14981D9 (tigm) IST13947G11 (tigm) IST14176G10 (tigm) IST10911F5 (tigm)
IST13479G9 (tigm) IST12417D12 (tigm) IST14577C11 (tigm) IST14553C8 (tigm)
IST15074H11 (tigm) IST12036G3 (tigm) IST11488E7 (tigm) IST10220D6 (tigm)
IST13632H12 (tigm) IST14806H2 (tigm) IST15060C8 (tigm) IST11651C3 (tigm)
IST10836G11 (tigm) IST14521B4 (tigm) IST14833C4 (tigm) IST10343C6 (tigm)
IST10197C12 (tigm) IST12023B2 (tigm) IST14703H12 (tigm) IST13636F1 (tigm)
IST11402E9 (tigm) IST10900D7 (tigm) IST10762G6 (tigm) IST10104A9 (tigm)
IST10466D12 (tigm) IST10762H10 (tigm) IST13123F6 (tigm) IST14754G7 (tigm)
IST10177H11 (tigm) IST14119G5 (tigm) IST11250H3 (tigm) IST12339A10 (tigm)
IST13172B2 (tigm) IST12294E5 (tigm) IST10747C8 (tigm) IST14299E10 (tigm)
IST11638A11 (tigm) IST10973D2 (tigm) IST10244B6 (tigm) IST14465D5 (tigm)
IST12836A2 (tigm) IST12492F11 (tigm) IST13918D5 (tigm) IST11171G5 (tigm)
IST12593B5 (tigm) IST14141B5 (tigm) IST11401D6 (tigm) IST11437B11 (tigm)
IST11775G5 (tigm) IST12107F3 (tigm) IST12455A9 (tigm) IST11549F4 (tigm)
IST13137G11 (tigm) IST13233C2 (tigm) IST11873C6 (tigm) IST13155G9 (tigm)
IST11359G10 (tigm) IST10907C5 (tigm) IST12950B10 (tigm) IST13659B10 (tigm)
IST12669F7 (tigm) IST13241E3 (tigm) IST15068F8 (tigm) IST14269F9 (tigm)
IST10810H3 (tigm) IST14381C11 (tigm) IST11745D3 (tigm) IST10263A12 (tigm)
IST12232C10 (tigm) IST13113D4 (tigm) IST12481A10 (tigm) IST13396F8 (tigm)
IST15055E11 (tigm) IST12503E9 (tigm) IST14674B4 (tigm) IST11541H4 (tigm)
IST10313A1 (tigm) IST11014D3 (tigm) IST12397A5 (tigm) IST13103C8 (tigm)
IST10082F8 (tigm) IST13186F7 (tigm) IST11266C2 (tigm) IST14046G5 (tigm)
IST10247E11 (tigm) IST11006H5 (tigm) IST11435C9 (tigm) IST14759D1 (tigm)
IST13885G4 (tigm) IST13961F2 (tigm) IST14415B5 (tigm) IST12002A3 (tigm)
IST10398H10 (tigm) IST13202C10 (tigm) IST14975F3 (tigm) IST10958G11 (tigm)
IST11508A9 (tigm) IST14189A12 (tigm) IST13046A9 (tigm) IST12921D11 (tigm)
IST14289F3 (tigm) IST14505E2 (tigm) IST12358G3 (tigm) IST10564F12 (tigm)
IST14734D7 (tigm) IST10026B3 (tigm) IST12347F9 (tigm) IST12986E3 (tigm)
IST14667E6 (tigm) IST14959A1 (tigm) IST14165B8 (tigm) IST14259H5 (tigm)
IST11736H11 (tigm) IST12273E8 (tigm) IST14716B11 (tigm) IST10749E8 (tigm)
IST14926H11 (tigm) IST10754B9 (tigm) IST10250E4 (tigm) IST11797F4 (tigm)
IST10485H5 (tigm) IST12846G1 (tigm) IST10462A9 (tigm) IST10410F3 (tigm)
IST10837G2 (tigm) IST11348H6 (tigm) IST11972E12 (tigm) IST11865D12 (tigm)
IST10446C9 (tigm) IST14625G7 (tigm) IST12977D3 (tigm) IST10480F6 (tigm)
IST10018H8 (tigm) IST14363B5 (tigm) IST11807C1 (tigm) IST10920G9 (tigm)
IST14601B11 (tigm) IST10673D11 (tigm) IST12429F12 (tigm) IST10945D2 (tigm)
IST13909C10 (tigm) IST12335A4 (tigm) IST10445E11 (tigm) IST13718F11 (tigm)
IST13697H11 (tigm) IST10365A7 (tigm) IST13373D2 (tigm) IST12346C6 (tigm)
IST10072C9 (tigm) IST11056G5 (tigm) IST14003F11 (tigm) IST14732A1 (tigm)
IST14701D1 (tigm) IST11064C5 (tigm) IST14862A1 (tigm) IST14179A12 (tigm)
IST11529E8 (tigm) IST10829E12 (tigm) IST12556C7 (tigm) IST10075A9 (tigm)
IST14549F2 (tigm) IST12839G3 (tigm) IST12674B4 (tigm) IST14375B5 (tigm)
IST10210A9 (tigm) IST12422F10 (tigm) IST12304H4 (tigm) IST14511F12 (tigm)
IST11112D8 (tigm) IST11586F9 (tigm) IST12074E10 (tigm) IST13784D9 (tigm)
IST10063C6 (tigm) IST13435A6 (tigm) IST14129C6 (tigm) IST13759H3 (tigm)
IST11731D11 (tigm) IST11336B11 (tigm) IST14720A5 (tigm) IST11534E8 (tigm)
IST11579F6 (tigm) IST10439H2 (tigm) IST10085B11 (tigm) IST14317F6 (tigm)
IST13976F3 (tigm) IST14157D2 (tigm) IST14903G6 (tigm) IST13169F8 (tigm)
IST11688H11 (tigm) IST13094E7 (tigm) IST14757E6 (tigm) IST11839F6 (tigm)
IST14259A12 (tigm) IST14432H9 (tigm) IST15029B7 (tigm) IST13969A6 (tigm)
IST14902C10 (tigm) IST11623C11 (tigm) IST14344G8 (tigm) IST12830F1 (tigm)
IST14843H8 (tigm) IST11533E8 (tigm) IST12013C2 (tigm) IST11111C7 (tigm)
IST13237E8 (tigm) IST10854G7 (tigm) IST14886G3 (tigm) IST10228C6 (tigm)
IST14035H8 (tigm) IST10663D8 (tigm) IST10219G10 (tigm) IST10210A4 (tigm)
IST12965A7 (tigm) IST10612E9 (tigm) IST10156B4 (tigm) IST13911E1 (tigm)
IST10175A5 (tigm) IST14565E6 (tigm) IST10617F4 (tigm) IST15112B5 (tigm)
IST12559F9 (tigm) IST12969B2 (tigm) IST14561H10 (tigm) IST15055C3 (tigm)
IST11405H11 (tigm) IST15025E5 (tigm) IST12000C12 (tigm) IST11115C5 (tigm)
IST14653D10 (tigm) IST14680F12 (tigm) IST14082E4 (tigm) IST14112B11 (tigm)
IST14498H10 (tigm) IST10879D10 (tigm) IST10565D6 (tigm) IST10549D1 (tigm)
IST12953D8 (tigm) IST13615G1 (tigm) IST14525H2 (tigm) IST10049A2 (tigm)
IST11039B2 (tigm) IST13237G5 (tigm) IST10837E1 (tigm) IST10290F4 (tigm)
IST11444F7 (tigm) IST13828E6 (tigm) IST11658C12 (tigm) IST14217H6 (tigm)
IST15011H2 (tigm) IST12063E5 (tigm) IST10368D5 (tigm) IST11204B11 (tigm)
IST11551E12 (tigm) IST12032F1 (tigm) IST10338D3 (tigm) IST11829F11 (tigm)
IST14094E8 (tigm) IST13185G2 (tigm) IST12633A10 (tigm) IST13289H2 (tigm)
IST14719E8 (tigm) IST14886B10 (tigm) IST12767G1 (tigm) IST10543E10 (tigm)
IST13963E10 (tigm) IST11457D2 (tigm) IST12863B11 (tigm) IST10125B4 (tigm)
IST14182H5 (tigm) IST11300C8 (tigm) IST13192G6 (tigm) IST10909H4 (tigm)
IST10900C1 (tigm) IST12472A8 (tigm) IST14121F8 (tigm) IST13746E5 (tigm)
IST14891F4 (tigm) IST14784C4 (tigm) IST12355A4 (tigm) IST10909C12 (tigm)
IST11593E9 (tigm) IST13398C7 (tigm) IST10407E6 (tigm) IST11793A9 (tigm)
IST14408B12 (tigm) IST10501F11 (tigm)
Private Clones OST441339 (lexicon) OST378009 (lexicon) OST337959 (lexicon) OST334187 (lexicon)
OST330133 (lexicon) OST321305 (lexicon) OST320504 (lexicon) OST318883 (lexicon)
OST299861 (lexicon) OST299196 (lexicon) OST293865 (lexicon) OST292035 (lexicon)
OST287673 (lexicon) OST281949 (lexicon) OST280286 (lexicon) OST276905 (lexicon)
OST275721 (lexicon) OST275420 (lexicon) OST273448 (lexicon) OST263229 (lexicon)
OST260882 (lexicon) OST248811 (lexicon) OST240233 (lexicon) OST232813 (lexicon)
OST225699 (lexicon) OST218830 (lexicon) OST210206 (lexicon) OST204126 (lexicon)
OST190854 (lexicon) OST188288 (lexicon) OST182601 (lexicon) OST173950 (lexicon)
OST173497 (lexicon) OST167999 (lexicon) OST154476 (lexicon) OST148474 (lexicon)
OST142154 (lexicon) OST137832 (lexicon) OST132037 (lexicon) OST130015 (lexicon)
OST129735 (lexicon) OST129639 (lexicon) OST122750 (lexicon) OST91563 (lexicon)
OST81108 (lexicon) OST65369 (lexicon) OST45661 (lexicon) OST37122 (lexicon)
OST36999 (lexicon) OST34894 (lexicon) OST34509 (lexicon) OST33593 (lexicon)
OST33292 (lexicon) OST32798 (lexicon) OST17201 (lexicon) OST3051 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13863
Vector Insertion
Chr 1: 84877776 - 84893064
Public Clones CMHD-GT_121C3-3 (cmhd) CMHD-GT_219C2-3 (cmhd) CMHD-GT_509C6-3 (cmhd) CMHD-GT_171C3-3 (cmhd)
(cmhd) FHCRC-GT-S10-7D1 (fhcrc) IST12331H6 (tigm) IST11631G9 (tigm)
IST11093H8 (tigm) IST12059G7 (tigm) IST12847B6 (tigm) IST11892D10 (tigm)
IST10142F6 (tigm) IST15054E6 (tigm) IST14421G11 (tigm) IST11038F6BBF1 (tigm)
IST10351F6 (tigm) IST14460H9 (tigm) IST15092A10 (tigm) IST14630F8 (tigm)
IST12534D2 (tigm) IST10767H10 (tigm) IST11322E6 (tigm) IST10921H11 (tigm)
IST14254D2 (tigm) IST10207C9 (tigm) IST12411C6 (tigm) IST12262F1 (tigm)
IST10017A6BBR1 (tigm) IST13271C2 (tigm) IST10606B4 (tigm) IST10447B7 (tigm)
IST14798B7 (tigm) IST11103H8 (tigm) IST12468H5 (tigm) IST14752B7 (tigm)
IST10207C9BBF1 (tigm) IST14887E3 (tigm) IST11038F6 (tigm) IST12332F6 (tigm)
Private Clones OST464907 (lexicon) OST464766 (lexicon) OST464365 (lexicon) OST463653 (lexicon)
OST456673 (lexicon) OST456472 (lexicon) OST455662 (lexicon) OST453540 (lexicon)
OST453464 (lexicon) OST450906 (lexicon) OST450156 (lexicon) OST449015 (lexicon)
OST448772 (lexicon) OST445277 (lexicon) OST443710 (lexicon) OST442087 (lexicon)
OST440611 (lexicon) OST439427 (lexicon) OST438337 (lexicon) OST437322 (lexicon)
OST435796 (lexicon) OST433862 (lexicon) OST433752 (lexicon) OST431353 (lexicon)
OST429499 (lexicon) OST425181 (lexicon) OST425177 (lexicon) OST425155 (lexicon)
OST418719 (lexicon) OST416739 (lexicon) OST416678 (lexicon) OST414370 (lexicon)
OST412178 (lexicon) OST405695 (lexicon) OST405590 (lexicon) OST404276 (lexicon)
OST403603 (lexicon) OST401073 (lexicon) OST390807 (lexicon) OST390496 (lexicon)
OST389171 (lexicon) OST388473 (lexicon) OST384987 (lexicon) OST378139 (lexicon)
OST377269 (lexicon) OST374595 (lexicon) OST368337 (lexicon) OST366578 (lexicon)
OST353753 (lexicon) OST353609 (lexicon) OST352087 (lexicon) OST351736 (lexicon)
OST347337 (lexicon) OST347264 (lexicon) OST346999 (lexicon) OST346377 (lexicon)
OST346007 (lexicon) OST345875 (lexicon) OST339308 (lexicon) OST335368 (lexicon)
OST334911 (lexicon) OST333335 (lexicon) OST330966 (lexicon) OST326366 (lexicon)
OST321695 (lexicon) OST319690 (lexicon) OST319242 (lexicon) OST315683 (lexicon)
OST315109 (lexicon) OST314334 (lexicon) OST309217 (lexicon) OST309186 (lexicon)
OST307867 (lexicon) OST307043 (lexicon) OST306547 (lexicon) OST299230 (lexicon)
OST292963 (lexicon) OST291382 (lexicon) OST290823 (lexicon) OST290050 (lexicon)
OST289130 (lexicon) OST288545 (lexicon) OST288514 (lexicon) OST286374 (lexicon)
OST285388 (lexicon) OST285191 (lexicon) OST283044 (lexicon) OST281406 (lexicon)
OST280127 (lexicon) OST278142 (lexicon) OST277050 (lexicon) OST275293 (lexicon)
OST274292 (lexicon) OST271115 (lexicon) OST270596 (lexicon) OST269798 (lexicon)
OST261569 (lexicon) OST256822 (lexicon) OST255983 (lexicon) OST255003 (lexicon)
OST254655 (lexicon) OST251741 (lexicon) OST247921 (lexicon) OST246808 (lexicon)
OST245480 (lexicon) OST244737 (lexicon) OST244694 (lexicon) OST242828 (lexicon)
OST240021 (lexicon) OST235597 (lexicon) OST233247 (lexicon) OST231402 (lexicon)
OST226031 (lexicon) OST214761 (lexicon) OST213035 (lexicon) OST211146 (lexicon)
OST209322 (lexicon) OST209276 (lexicon) OST208768 (lexicon) OST207416 (lexicon)
OST207228 (lexicon) OST207138 (lexicon) OST206783 (lexicon) OST205949 (lexicon)
OST204076 (lexicon) OST203322 (lexicon) OST201888 (lexicon) OST199655 (lexicon)
OST197720 (lexicon) OST195063 (lexicon) OST192379 (lexicon) OST190842 (lexicon)
OST189085 (lexicon) OST188893 (lexicon) OST184428 (lexicon) OST183846 (lexicon)
OST183811 (lexicon) OST182518 (lexicon) OST182366 (lexicon) OST181812 (lexicon)
OST179058 (lexicon) OST177585 (lexicon) OST176800 (lexicon) OST176087 (lexicon)
OST175526 (lexicon) OST172602 (lexicon) OST168775 (lexicon) OST168410 (lexicon)
OST167374 (lexicon) OST159247 (lexicon) OST152219 (lexicon) OST148118 (lexicon)
OST142142 (lexicon) OST141638 (lexicon) OST139489 (lexicon) OST137022 (lexicon)
OST132447 (lexicon) OST129089 (lexicon) OST126573 (lexicon) OST125093 (lexicon)
OST113447 (lexicon) OST100421 (lexicon) OST99900 (lexicon) OST98199 (lexicon)
OST95901 (lexicon) OST83721 (lexicon) OST79789 (lexicon) OST78844 (lexicon)
OST74364 (lexicon) OST68884 (lexicon) OST65371 (lexicon) OST63306 (lexicon)
OST61470 (lexicon) OST59108 (lexicon) OST58023 (lexicon) OST54434 (lexicon)
OST48272 (lexicon) OST43064 (lexicon) OST31808 (lexicon) OST31530 (lexicon)
OST27912 (lexicon) OST27236 (lexicon) OST25472 (lexicon) OST23972 (lexicon)
OST21690 (lexicon) OST20708 (lexicon) OST17162 (lexicon) OST15944 (lexicon)
OST8467 (lexicon) OST8444 (lexicon) OST8329 (lexicon) OST7276 (lexicon)
OST6937 (lexicon) OST6754 (lexicon) OST6057 (lexicon) OST5678 (lexicon)
OST5604 (lexicon) OST372 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19123
Vector Insertion
Chr 1: 84893238 - 84896571
Public Clones not available
Private Clones OST404066 (lexicon) OST371358 (lexicon) OST336240 (lexicon) OST309572 (lexicon)
OST302464 (lexicon) OST302257 (lexicon) OST285145 (lexicon) OST282968 (lexicon)
OST277066 (lexicon) OST266338 (lexicon) OST250041 (lexicon) OST242501 (lexicon)
OST213655 (lexicon) OST208530 (lexicon) OST207723 (lexicon) OST200220 (lexicon)
OST200068 (lexicon) OST194555 (lexicon) OST193274 (lexicon) OST191938 (lexicon)
OST185822 (lexicon) OST184858 (lexicon) OST183002 (lexicon) OST139122 (lexicon)
OST126377 (lexicon) OST108075 (lexicon) OST88167 (lexicon) OST71396 (lexicon)
OST50129 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097672
Sequence
GTCCTAGCGACGGCGGTGGCGTCCCAAGATGGCGTCGTGGCTGCCGGAGACTCTGTTTGAAATTGTAGGACAAGGCCCAGCGCCGAGCAAAGACTATTAC

CAGTTGTTGATCACCCGGACTCAG - UNI13061 - ATCATCTTTAGATGGTGGAAGATTTCTCTGAGAAGTGAGTATCGGTCAGCAAAACCTGGAGA

AACAAAGGAAAGCCATGAAGACTTCCTAGATAACTCTCATCTCCAAG - UNI13863 - TTCAAGTCGCCGTAGTATTTGGTACAAAAATATTAGACT

ATGTCTTCAACCTGTGCGAAGGTAAATTTGACTACCTGGAGCGGCTCTCCGACAGACTGCTGCTGAAGATCATCTGCTACCTGGACCTGGAAGATATTGC

CAGCCTCTCCCAGACATCAAGCAAGTTTGAGAAG - UNI19123 - TTGTGCAAGAGTGACTTGCTGTGGGAACAGATAGTCCAGTCCACCTGTGACA

CCATCACCCCTGACATGCGGGCCTTGGCGAAAAACATGGGCTGGAGGCAGATGTTCCTCACCAACAACATCCAGCTCCAGAGGCAGACCCGCAAGAAGAA

GCAAAGACAGGAAAACCAGGCAGAGAAGCTTGCTTAGGGGATGGCTGTTTCCAACAGCGGAGCCACAGTGGTCCGAATCTCCAGGTCCAAAGCTCACTCT

CTCTTAACAACAGGTTCTGCCGATTCCAGCATCACTTGAAAACCAGATTTTGCACACACATGCAAATCCACCTAGTGCCTTGCTCAAGCAACCCCCTCCT

ATTGCCCAACCAGGGCCCAAGTACTAAGGGCTTCGAGCCAGGAAGTCTCTTAGACTACCACCTCCCTGATCCCCTTTTGCCCCACCCCCCAGGAAAGAGG

CACTTGTATATGAACTAACAATAAAGAGCTATCAGC
Translation
MASWLPETLFEIVGQGPAPSKDYYQLLITRTQ - UNI13061 - IIFRWWKISLRSEYRSAKPGETKESHEDFLDNSHLQV - UNI13863 - VQV

AVVFGTKILDYVFNLCEGKFDYLERLSDRLLLKIICYLDLEDIASLSQTSSKFEK - UNI19123 - LCKSDLLWEQIVQSTCDTITPDMRALAKNMG

WRQMFLTNNIQLQRQTRKKKQRQENQAEKLA

For any suggestions or comments, please send an email to unitrap@crg.es