Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000073991 (AL805966.7)
Chromosomal location
Chr 4: 18787602 - 19049633 (-)
Description
Novel protein Fragment  [Source:UniProtKB/TrEMBL;Acc:B1AWM0]
Human Ortholog
not available
Omim not available
UniTrap UNI35643
Vector Insertion
Chr 4: 18834142 - 18982297
Public Clones IST11180F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098249
Sequence
ATGCCTGTGGATTCTCTTCCAAACAGTATTTTGGCCCACATGTTAGCCATTAGCAATGTGCCTCCTCCTCCACTTCACAGTTTGCCAC GCCTGAGACTG

AGCAAAACCATTAATTATGGTCAGCTGAATGCCTTATGCCACATTAGAGGACTAAAGAGCGA CCAGCATTCTTCCCTTCGTTCGGAAGCTCATGATGCT

TTCATCAAGCAATATCCTCAAATATTCCTGCGTGAAAAGACAGTGTTGCCTAAAGTTTCTCACCAGGTTGACAAAAG - UNI35643 - AAAATCTGC

TCTAAAGCTAGCAGAAAAGAAACACCAACCTGTTATGGCACACAACATATCTGCCTATCTTAGAGAAGCTCGTGGTGGCCCTTCTATTGATGAAAAAGAA

ATAACTGAAGAAAAGTTCCAGGAGTTCTTAAATATCTTAAAGAAGCT - UNI35643 - GCCAGTTTATAGAACAACACATGAGCATAACATGGTGTG

GAAGATTTTGCAGAGTATTCCAGAGTTAACCTCTCAATTTAGCAATGAGGATCTGAAAATCCTGAGTAAGAAAGTGATATCTGAAACCTGGATCAAAGGT

AGCACAG - UNI35643 - TGATTGGTGATGATGGACTTTATGTCTTACTGACGGGCCAGGCTCGACGTCGTGTAAAGGTGTTTAGAAGTCTGATCGA

AGAAAATGACTCAATCATCACTTCACTCTACAGGGATAGTTTTCTTTTTGATGCAGAGTTACAAGATTCTACAGTGGCTCAGCTGTATGTACCTTCAAAG

AAATTAATA GTGAAACAGTGGGGTATCTTTGGATCACTGAAAGACAGAGCTGAAATGGATGAACGTGACCGTTCAGTTGTGACAGATTATGACTGTGAA

ATCCTGAAAATAGCTGCAAAGGAGTATGAGAAGTTAAAATTG GAAAAAGTAAAGCATGAAAATGCACAAAAGTTGAAATTAATCCGCAAGTGTCCTTTT

TATGAAACCTGGCCTACTTTATCCATATGGGAGCTAGTTTCAATTTGTAAATTCAAAAATTTTCCTCCAGGACATG TGTTAGTAGAAAGTGGAACTGTC

ATTTCATTTGTGGGTTATATCAACTCTGGATATTGTAACATTTACAGAAATGTTGTTGGACTTGTGGACCTACCAATAAACAAAGTG AAAAAAATTAAA

AAACTTGTTTATATGGGTAAACTTAAGGAGAAGGAGTCCTTTGGTGAGATCAGTATTCTTCTTCAAGCTCCCTTCACATGCACAGTTATTACTGGACAAG

AAGTTGAGATGGCAGTTATTGAAGATAAGGACATACAG
Translation
MPVDSLPNSILAHMLAISNVPPPPLHSLPR RLRLSKTINYGQLNALCHIRGLKSD DQHSSLRSEAHDAFIKQYPQIFLREKTVLPKVSHQVDKR - U

NI35643 - RKSALKLAEKKHQPVMAHNISAYLREARGGPSIDEKEITEEKFQEFLNILKKL - UNI35643 - LPVYRTTHEHNMVWKILQSIPEL

TSQFSNEDLKILSKKVISETWIKGSTV - UNI35643 - VIGDDGLYVLLTGQARRRVKVFRSLIEENDSIITSLYRDSFLFDAELQDSTVAQLYVPS

KKLI VKQWGIFGSLKDRAEMDERDRSVVTDYDCEILKIAAKEYEKLKL EKVKHENAQKLKLIRKCPFYETWPTLSIWELVSICKFKNFPPGHV VLVE

SGTVISFVGYINSGYCNIYRNVVGLVDLPINKV KKIKKLVYMGKLKEKESFGEISILLQAPFTCTVITGQEVEMAVIEDKDIQ

For any suggestions or comments, please send an email to unitrap@crg.es