Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074085 (Snurf)
Chromosomal location
Chr 7: 67133488 - 67144657 (-)
Description
SNRPN upstream reading frame Gene [Source:MGI Symbol;Acc:MGI:1891236]
RefSeq_peptide
NP_149409.1 
MGI
MGI:1891236 
Uniprot/SWISSPROT
Q9WU12 
Human Ortholog
ENSG00000214265 (SNURF)
Omim not available
UniTrap UNI31991
Vector Insertion
Chr 7: 67140291 - 67144304
Public Clones IST14935E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098402
Sequence
CTGTTTCAGG - UNI31991 - TCAGGGATCGCTTACACTTGAGAAGAACTACTGAACAGCACGTGCCCGAGGTCGAGGTCCAGGTCAAACGTCGAAG

GACAGCCTCACTGAGCAACCAAGA - UNI31991 - GTGTCACTTGTACCCACGACGTTCTCAGCAACAGCAAGTTCCTGTGGTGGATTTCCAGGCAG

AACTAAGACAGGCATTCTTAGCTGAGACACCAAGAGGTGGTTAAAGCAGTATTGCAACTTCAAGGTGGTGGAATTCAAGGAAAACAG - UNI31991 -

 GACCCATCCTCTGTCTGTGAAACTTTGGTCAAGCTTACATTGTTTGTTAATAGCCTGCATCGAACCTTTATTTATATCCCTTCCCCGAGTATTAAGGAT

CTTGAAATTTTAGTGTTGACAACGGCTATTGTGGAACAGCAATCATG
Translation
LFQV - UNI31991 - VRDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQE - UNI31991 - ECHLYPRRSQQQQVPVVDFQAELRQAFLAETPRG

G - UNI31991 - 

For any suggestions or comments, please send an email to unitrap@crg.es