Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074146 (4930579C12Rik)
Chromosomal location
Chr 9: 89007949 - 89072725 (-)
Description
RIKEN cDNA 4930579C12 gene Gene [Source:MGI Symbol;Acc:MGI:2441687]
Human Ortholog
not available
Omim not available
UniTrap UNI36302
Vector Insertion
Chr 9: 89007948 - 89020654
Public Clones IST11837F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098484
Sequence
AGTATACTTTGAGACTTTGCCCAAAGTACATGTCTATAACTACAGAGCGATAATAGTATTGGAATTTGAGTATAATGGGGAACTGTTGTGACACCAGAG 

TTTTACCTCAACAGTCTACTGTTACACCCTTCTCAACTGATGACCATCCGTGTACAAAATCCTCATTGACC GTGGGCTCCAGAAAACGCCGGAACA TA

TTTACAATCATAAGAAATATCCATCACCAGAATGCTGCTGTTACTGTGGATACTGAAGAACATCAAGCCCCAACTTGCTCATCCACACAAACACCACAAA

ACAAAAGAAAAG CTAAATGTGGTGATGGTACACCTTCAGAAGAGGACGAGGAAAAGTCATCACTGAGGAGGGTTAAG GTAGTTTCTAAAAGAAGCAGA

CAGA GCTCACCTTTCTTGAGAAATAAGTTTCGGAGGGGCACTCTTCTCCCAGTGGATGCTGCACAATGTGACTTCACAGATAAAAGTTATAAAGGAAAA

CCACAAGACAACCTAGAAG TGGTAGCTCAATGTTCTGATGGTGCAGCTTTGCCAGTGGACAAGGGGAAAGGAGCAGTGAAAATGGTGGAG GCAACATC

GAAAAAACGAAGATGTG TTTCTGCAATCTTAAAGCTATTTTCTCGAAAGCGAGTTGTGGCCCCCCTTAAAGAGAAAAGACCTCAAGTACTCCCTGGCAC

CTCCAAAGAAACAGCACCCGTTACAACAGAAG TGGTACCTGAAAATGCGAACACTGCACCATCAGCAAGGGGACAGGGAGAGCCACCAGTAGGGATGGT

GAAG GTGGAGACTAAAAAGCGTAGACACAGTATGTATTATAGAATCTCTTAAGATACATTTTAGAAAGGAATTGCATAAACACTAGATATCCTTTTCTC

TAGTGTACAATGGTGCTCTAGCCCACCTACTGGGAAGAACTTGTATTCAGTTGTTCGTTTGGTTTTTTTGTTTTCTTTGGTTTTGTTTGTTCATTTTTTT

CTTAAATATTACCTTAACTTAAAAGAAAAACTGGAGGTGTTTGTCTACCATAACTGGATTCAAGTATGATCTCTCTAAGTTGTTTAAGATGTGCTATACC

AGGCAGAGTCTAAATCTGTTTTTTCTCAAGATAGGTACCCTAATTACTCAGATCAATCTCCATTGACAAAGTAAGGAAGTAACAAATTAGAATACAGAGT

TTACCTACAAAATATGAGTTGAAAGTTCATCACATGTAGTGCATTCATTTCTTTATGGTGGTACTCTAGTGAAGAATAAGCCAGGGCACAGAGGTGAGTA

TTGTGGCTCTCCATGCAGATCAACAGACACTTTGTGTAGCAAGCACTTAGTGATGCCTATATTTCATATTCCCAGCATCTTCCTTCAGTAGGTCAAAATC

ACAGAGAGCCCAGACTCTGCCATGATTACCACAGTGGGCAGAGCCAGGGCTTTGCTCTCCATCTGCCACAGACATACATCCACAAGCATGTGATGTAGAA

AAGAACACTCACTTCTAGTCAGACCATAGATTCTGACAATGGGAGCCCAACACTGTATGAGGGGACATTTGTCACCTACAATGACACCAAGCTGCCTTTC

CAGTCTCCTCCAGTTGAGGGTTTATCTAGGTATGACCAGATCAAAAGAAGCTGCCATTTGCACACCTTCATGTGAGAACGGGGTTGTACTGACTTGGAGT

CTGAGTCATCAGTGGGACTCTGCAGGCTTTGGTCCCCTCCCGATTCTGTTCCTCAGTGATCAGACTCAGTCACTGAGAGCCAGGTCACAGTGTGAGGATG

GTGGAGGAAGGCCCTGTTTACTGATCCAGGAATCCCACAACTTCTTTTGGGCTGAAAGGTAGCCTATGTGTACCTTCACTTATATCTGTCAGGGAAGATG

GCCACTGATGCATGAATGCAGCTATCATTGTAACCTTGGGTGAAAAGTCAGAGGGCCTCACAGCTTCTTACCTCCCCTACATCCCACTAAGGCAATGCCA

TACATTGCCTGTGAGATGTAGTTGATAAGAATGAAGAGTAAACAAGTGTTCTACAATGTTCTGGTATAAATGCATTCCTGAGTCCAGGCGCAGTTACTCC

TATGCAGCTGAGGTCTTCTGGCCTGTCACAGACATCACAGGGCACTCCAGCAATGCCTGTGCTTTCCCTACAGTGTACACTAAAGAGATTGATCTGTTCT

AGCCTAGTGAGTCTCATGGGAAGTCCTTCTCCACCAACTAAGAAGGAAGTCTTTGTGTTGTAGTGAAGAGTTGCTGGCTGAAGGCATTGCATGGGTGTGG

CTGTGTACTTGAAGGGTTAGAGTGAAGCCTATTGGGCAGCACACTCACACAGCATGCTCAGTCATATGAATCTTCCCTCTGTGTTTTTATATCCATCTAT

GTTTAGGCTCTATCTGGGAATCCTGTGATGTCCATTCAATGCCTAACTCATTTTACACAACATGTAGTGCTCCTCCTCAAGTACCAGTCTCACTCTGATG

ACTGTATCTGAAACAAGCAGTCAGATCAAATGCACAAATACTCAGTAGTTGTTAGTTTGCTTGAGTTTTCTGCCAAGAAGCTGACTTATTCCCTATTATA

ATTGCATTCTCAGTTTTTTCTTTTTTAAGGGGAATTTGTCATAAGACAACTGTAGTCCCCCAGGACACGCAGAGACCTTCAGTCTCTAAGGCTACATCTA

CAAAAACAACTGAAATAAAAAGAAAAG ACATACCGGAGAATGCTGACAACAAACTTGCACAAGATGCCCAAAAACACACATCAGAGAGCATTGAGTCG 

GTGGAAGAAAGAAAACAGAGACGCA TTTCTGCAATACTCAAAAGAATGGAATGCAAGCAAGCCATATGCCCTTCTGAGGTGAGGCAACTACAAGGCTGT

ACAATTCTTTCACCTAAAACAAGAGGAAAGAGTGATAAAG TTTCTTCATTCTTTAGAAAATTTTATAGGAAGGACTCAAGTCCCTTCCAGGCTCCGGAG

GAACCTCCAGCCCTTGAAGGGACATCCAAAGAAATGCAACCAACTACTAAAAGAG GCAGTCACAATGCACCTGAAATTAAGGAGATATTTTATAGAGAA

GAAGAGTTGGAATATCTTGATGAG GGTTCCTTGGAAGAATCTCAAAGCT GCAGTCACAATGCACCTGAAATTAAGGAGATATTTTATAGAGAAGAAGA

GTTGGAATATCTTGATGAG GGTTCCTCGGAAGAATCTCAAAGCT ATGGTATCAATGTTCCAGAATCCCGAGAAACC ATTACTTCCACCATGAGACAG

CGTT ATTTTCTTCCAGATATTGATAACATAGAAGACACAGATACTGAAAATGCACAAAAAGCTGTGGATAGTCAATCTG - UNI36302 - AATCAA

CTCAGCTAGAATACTGGGACCTGAGAAATAAATCGTCTACTGTTTCTCCTG - UNI36302 - TATCGTGTAGAAGACAGCAGACTTGCCGGCTCTGG

GCACCTGTGACACATGCTGCTACCTGGGCTGTTTATGAACAACAATCTTTGGGACCAGCCTCAGAGGAACTTCAACAGCTGTCTGCATAGATCAAGGCAG

ATCTCTATGATCAACTTCAGGTCCCTGTTTGCAGTGCCTGTTTAGGCAAATTGACATCTCTTTATGATATATTCTTAGAACTTTGTGTTTCTATGTGCTT

TTAGCTTCATTAAAGGTCTATAAATT
Translation
MGNCCDTRV VLPQQSTVTPFSTDDHPCTKSSLT VGSRKRRNI IFTIIRNIHHQNAAVTVDTEEHQAPTCSSTQTPQNKRKA AKCGDGTPSEEDEEK

SSLRRVK VVSKRSRQS SSPFLRNKFRRGTLLPVDAAQCDFTDKSYKGKPQDNLEV VVAQCSDGAALPVDKGKGAVKMVE ATSKKRRCV VSAILKL

FSRKRVVAPLKEKRPQVLPGTSKETAPVTTEV VVPENANTAPSARGQGEPPVGMVK VETKKRRHSMYYRIS            - UNI36302 -  -

 UNI36302 - 

For any suggestions or comments, please send an email to unitrap@crg.es