Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074166 (AW146154)
Chromosomal location
Chr 7: 48734244 - 48755260 (-)
Description
Putative uncharacterized proteinExpressed sequence AW146154MCG140425, isoform CRA_b ;; [Source:UniProtKB/TrEMBL;Acc:Q3TPQ7]
RefSeq_peptide
NP_001028702.1 
UniGene
Mm.370336 
MGI
MGI:2142212 
Uniprot/SPTREMBL
Q3TPQ7 
Human Ortholog
not available
Omim not available
UniTrap UNI21473
Vector Insertion
Chr 7: 48738330 - 48754663
Public Clones not available
Private Clones OST329399 (lexicon) OST183476 (lexicon) OST130324 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098509
Sequence
ACCTGGTTCCTGGGCAGGTGAGGCTTACAGGTCAAATTTGGGAATTACAATTTTCAAGCTTGATTTCCATTACATATCCACCTTCATTTCCGGAGGAAGA

AGGGGAAGTGCCTAATGAATAAAGGTAGTTCAAGCAAGCTCCAGATTCCACCACGACTTAGAAAGCGCAGGGTCGTTGTTTACAAAGGGGAGGAGCAGGC

AGCTGGGCGGCAGGAGCTGAGGTGATGGGTCCTTCCCGGTGCGGGATGGAAAGACAGACGGGTAGAATACAGACACAAGTGCTACTGAAATGCAAATCTC

TATGTATCTGGAAAAGGTCTGGTACTGTACTGGAAGACCCGGCCAGCAACCATCATGCGGAGTCTCATCTGCACACCCTAACCCTCAGGGAGGTACTCGC

GTTACTCAAGACTTAAGGGCCAATCAGAGCCTTGAGGTGGACCTGCCAGTCAGAAAAGGAGGCGGGATCTTCCGGGTGCCTTGCGGCAGCTTCAGCTCTG

TAGCGGAGCGGGCTGGAAAAGTTCTGATTGTTTTTCTCTAAGCGCTGCTGCTGGGTGCTGTGAGGGAAGCTCTAGCAAATTGCTAATTCGCGACATG - 

UNI21473 - AATGGAATGACCTATGATGATGTGCATGTAAACTTCACTGGCGAAGAGTGGGCTTTGCTCAGTCCTTCCCAGAAGAGGCTCTACAAGGA

TGTAATGCTGGAAACCTACAGAAACCTCACTGCTATAG GTTGCAGTTGGGAAAACCGTAATATTGAAGAATATTTTCAACGTTCTAGAAGATATGGAAG

 GCATGAAAGAAGTCATACTGGAGAAAAACCTTCTGTATATACTCAATGTAATAAAGCATTTGCATATCAGAGTCATCCTCAAAGACATCATCGCATTCA

TACTGGAGAGAAACCCTATGAAGGTATTCAACATGATAAAGCCTTTGCACATCACAATCATCTTCCAAGGCGTGAAAGAATTCATGCTGGAGAGAAACCT

TATAAATGCAATCAGTGTGGTAAATCCTTTGCACACTGTAGTTACCTTCGAAAGCATAAAAGAATACATAGTGGAGAGAAACCCCATGAATGTAATCAAT

GTGGTAAAGCTTTTGCATGTCACAGTAATCTCCGAATACATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTAACCAGTGTGGTCAAGCCTTTGC

ATGTCAAGGAAATCTCCGATTACATGAAAGAACACATACTGGAGAGAAACCCTATGAATGCAATCAATGTGGTCAAGCCTTTGCATCTCACAGTCATCTC

CAAATACATAAAAGAACACATACTGGAGAGAAGCCCTACAAATGTAATCAATGTGATAAAGCCTTTTCACAAGGTAGTTCACTACAAATACATAAAAGAA

CACATACTAAAGAGAAACCCTATGAATGTAATCAATGTGGTAAAGCCTATATATGTCACAGTAGTCTCCGAATACATAAAAGAACACATACTGGAGAGAA

ACCCTATGAATGTAATCAATGTGGTAAAGCCTTTGCAAGTCACAGTACTCTCCGTATACATAAAAGGACACATACAGCAGAGAAACCCTATGAATGTAAT

CAATGTGGTAAAGCCTTTACCCGGCACAATAGTCTCCAAATACATAAAAGAACACATACTGGAGAGAAACCCTACAAATGTGATGAATGTGATAAAGCCT

TTGCACAACAAGGTCATCTCAGAATACATAAAAGAACACATACTGGAGAGAAACCTTATAAATGTAGTCAGTGTGATAAAGCTTTTGCACGTCATAGTCA

TCTTCAAATTCATGAAAGAATTCATACTGGAGAGAAACCTTACAGATGTAATCAATGTAATAAAGCCTTTGCACAATATGGTAGTCTTCAAATACATAAA

AGCACACATACTGCTGAAAAGCCCTACAAATGTAATGAATGTGGTAAAACTTTTTCACAACTCAGTTATCTCAAAATACATAAAAGAACACATAATAGAG

AGAAACCCTATAAATAAACAATGTGGTAAAGCCTTTTTGTGTAATCTTAGAAATCAAGAGCCAATTCATACTGCAGAGAAACCTTATAAATGTAGTCAGT

GTGGTAGTTTTGTACTTCATGGTATCATTATACAAGAGTAAAACCTTTGGTATTATCAATCTATTAAAGCCTTTGCATATCACAGTAGTTTTGAGTGGTG

ATAAAACTCACACTGAAGGGATTGTATGACTATAAAGAATTTGGTAAGATATTTAGCCAATACATTTCCATTAAGTTACAGATCATTTATCCAGGGGAAT

AGATTTGACTAGTGTCACCAACATCTTCAGGCATTATTATATCCCTGTTTATTATGCCCTGATGACCTGGAAGAAATATACGATTGACTGCATCAGAAGT

ATCTGAAGCCTTGGCACTTTAAAGAAATTTCAGAGTCCCAAATCTCTACAGAATGAAGAAGAGTGAAAAGAAAGATCAGGAGAGAAACTGACAAGTCTTA

AAAAGTGGCTGAGCACTTGACCAATGCCACAAGACAGTTTATCTCAAATGTGGTAAAAAGACAGCAATGGGAGCAAGCCCACAAGGAAACTTTGTACATT

GTATGCCTGCTGGAGTTGATGTCCCGCATAAGGAGAGAAAGAAATACGCAGGGGTGAAGACTGGCTTGTTAGATCAGGATCGTATTCTGCTTCTCTGAAG

CCTGTAAAATTCTGTTAGGAGGACACCTGGACTCCCAAGACTCAACAGGAGTCAGTCACTCTAAGACTGGAGCAATCATGTCTTTGCAAAGAGCTGTGTG

AGGTATGGATGAACTATGAGGGCAAGAGCTTTGGATTGGAAAGCCAAAGGACCAAATGACTAGAGGGCAACGCTCAGGGTGTACCTGAGGACAAGCTGGC

TCCTACTGTGCTCTCTGCATTCACTTAGCTGTCATGGGTCAGCCCCTCCAGGTCTTCCACTCTTTCCTTATTCTTGGCAACTACAATGTAGCTGTCAGTA

AGAGCACTGTGCTCCTTCCCTGGCAGACCCCACCCATTCATTAATCCTTGTAACCTGCTTCCCTGGAAGACTAAGGATATTCTAAAGAGATATTTCTTTT

CCTTTGGCTAACAATTAGTGAACCGGTGGGCTGCATGAAATTCAAATTTCCTGGGTAATCACATTCTGGGTAAGATTGAGTCCTCCATCGAAGAAGGCTT

TTGCTGAAGAAACATTTGCACATTGCAGGAGTCAGAGGAGCTAAGAATGGGGTATGGTTTGAGGGATGGCTGGAAAATTCTTATACTGCTTGGATGGATT

ACTTAGCATCTATCTCTTTCCTTCCACCTAAATATGTCATTACCCCCAGTGATTGAATAGTTTGCTTCTATCTTTGTCACTATTCCAGTTTAGTTGCACT

CAATAAATTTGTTTCTAATTTTATGAC
Translation
M - UNI21473 - NGMTYDDVHVNFTGEEWALLSPSQKRLYKDVMLETYRNLTAIG GCSWENRNIEEYFQRSRRYGR RHERSHTGEKPSVYTQCNK

AFAYQSHPQRHHRIHTGEKPYEGIQHDKAFAHHNHLPRRERIHAGEKPYKCNQCGKSFAHCSYLRKHKRIHSGEKPHECNQCGKAFACHSNLRIHKRTHT

GEKPYECNQCGQAFACQGNLRLHERTHTGEKPYECNQCGQAFASHSHLQIHKRTHTGEKPYKCNQCDKAFSQGSSLQIHKRTHTKEKPYECNQCGKAYIC

HSSLRIHKRTHTGEKPYECNQCGKAFASHSTLRIHKRTHTAEKPYECNQCGKAFTRHNSLQIHKRTHTGEKPYKCDECDKAFAQQGHLRIHKRTHTGEKP

YKCSQCDKAFARHSHLQIHERIHTGEKPYRCNQCNKAFAQYGSLQIHKSTHTAEKPYKCNECGKTFSQLSYLKIHKRTHNREKPYK

For any suggestions or comments, please send an email to unitrap@crg.es