Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074179 (AC138587.1)
Chromosomal location
Chr 9: 78137730 - 78153332 (+)
Description
Glutathione S-transferase (EC 2.5.1.18) [Source:UniProtKB/TrEMBL;Acc:Q8K0V9]
RefSeq_peptide
NP_001116132.1 
UniGene
Mm.475927 
Uniprot/SPTREMBL
Q8K0V9 
Human Ortholog
ENSG00000182793 (GSTA5)
Omim not available
UniTrap UNI28750
Vector Insertion
Chr 9: 78145958 - 78146743
Public Clones not available
Private Clones OST21642 (lexicon) OST6334 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121273
Sequence
TTACTAAAGTATCGTGCACACTCCTCTGGAGCTGGACTGGGAGCTGAGTGGAGAAGAAGCCAGGACTCTCACTAG ACCGTGAACCACAGTTGCTGCAAT

GGCCGGGAAGCCCGTGCTTCACCACTTCAATGCCCGGGGCAGAATGGAGTGCATCAGGTGGCTCCTGGCTGCAGCAGGGGTGGAG TTTGAAGAGAAGTT

TATACAGAGTCCGGAAGATTTGGAAAAGCTAAAAAAAG - UNI28750 - ATGGGAATTTGATGTTTGACCAAGTGCCCATGGTGGAGATTGATGGGA

TGAAGCTGGTGCAGACCAGAGCCATTCTCAACTACATCGCCACCAAATATGACCTCTATGGGAAGGACATGAAGGAGAGAGCCCT GATTGACATGTATT

CAGAAGGTATTTTAGATCTGACTGAAATGATTGGGCAATTGTTAATATGTCCCCCAGACCAAAAAGAAGCCAAGACTGCCTTGGCAAAAGACAGGACCAA

AAACCGTTACTTGCCTGCCTTTGAAAAG GTGTTGAAGGGCCATGGACAAGACTACCTTGTGGGCAACAGGCTGACCAGGGTGGACGTCCACCTGCTGGA

ACTTCTCCTCTATGTTGAAGAGTTTGATGCCAGCCTTCTGACTCCTTTCCCTCTGCTGAAG GCCTTCAAGAGCAGAATCAGCAGCCTCCCCAATGTGAA

GAAGTTCCTACATCCTGGCAGCCAGAGAAAGCCTCCCTTGGATGCAAAACAAATTGAAGAAGCAAGGAAGATTTTCAAGTTTTAGTGTGGCTACATTGAT

GGAGCCACAGATACTGGCCTCTAATGGTTTGCAATTATAAAATACAATTGTTGATTTGGCTATTGTGCAATAATAAAAAATTAACAAATGGT
Translation
 MAGKPVLHHFNARGRMECIRWLLAAAGVE FEEKFIQSPEDLEKLKKD - UNI28750 - DGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYG

KDMKERAL LIDMYSEGILDLTEMIGQLLICPPDQKEAKTALAKDRTKNRYLPAFEK VLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPL

LK AFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKIFKF
Transcript ENSMUST00000119823
Sequence
TTACCTTACTAAAGTATCGTGCACACTCCTCTGGAGCTGGACTGGGAGCTGAGTGGAGAAGAAGCCAGGACTCTCACTAG GGTTTCTATTCCTGCACAA

ACCAAGAAGCAAGTTGGGGAGGAAAGGATTTACTCAGCTTACACTTCCACATTGCCTTTCATCACCAAAAAAAGTCCGGACCGGAACTCAAACAG ACCG

TGAACCACAGTTGCTGCAATGGCCGGGAAGCCCGTGCTTCACCACTTCAATGCCCGGGGCAGAATGGAGTGCATCAGGTGGCTCCTGGCTGCAGCAGGGG

TGGAG TTTGAAGAGAAGTTTATACAGAGTCCGGAAGATTTGGAAAAGCTAAAAAAAG - UNI28750 - ATGGGAATTTGATGTTTGACCAAGTGCC

CATGGTGGAGATTGATGGGATGAAGCTGGTGCAGACCAGAGCCATTCTCAACTACATCGCCACCAAATATGACCTCTATGGGAAGGACATGAAGGAGAGA

GCCCT GATTGACATGTATTCAGAAGGTATTTTAGATCTGACTGAAATGATTGGGCAATTGTTAATATGTCCCCCAGACCAAAAAGAAGCCAAGACTGCC

TTGGCAAAAGACAGGACCAAAAACCGTTACTTGCCTGCCTTTGAAAAG GTGTTGAAGGGCCATGGACAAGACTACCTTGTGGGCAACAGGCTGACCAGG

GTGGACGTCCACCTGCTGGAACTTCTCCTCTATGTTGAAGAGTTTGATGCCAGCCTTCTGACTCCTTTCCCTCTGCTGAAG GCCTTCAAGAGCAGAATC

AGCAGCCTCCCCAATGTGAAGAAGTTCCTACATCCTGGCAGCCAGAGAAAGCCTCCCTTGGATGCAAAACAAATTGAAGAAGCAAGGAAGATTTTCAAGT

TTTAGTGTGGCTACATTGATGGAGCCACAGATACTGGCCTCTAATGGTTTGCAATTATAAAATACAATTGTTGATTTGGCTATTGTGCAATAATAAAAAA

TTAACAAATGGTA
Translation
  MAGKPVLHHFNARGRMECIRWLLAAAGVE FEEKFIQSPEDLEKLKKD - UNI28750 - DGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLY

GKDMKERAL LIDMYSEGILDLTEMIGQLLICPPDQKEAKTALAKDRTKNRYLPAFEK VLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFP

LLK AFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKIFKF
Transcript ENSMUST00000095071
Sequence
ATGGCCGGGAAGCCCGTGCTTCACCACTTCAATGCCCGGGGCAGAATGGAGTGCATCAGGTGGCTCCTGGCTGCAGCAGGGGTGGAG TTTGAAGAGAAG

TTTATACAGAGTCCGGAAGATTTGGAAAAGCTAAAAAAAG - UNI28750 - ATGGGAATTTGATGTTTGACCAAGTGCCCATGGTGGAGATTGATGG

GATGAAGCTGGTGCAGACCAGAGCCATTCTCAACTACATCGCCACCAAATATGACCTCTATGGGAAGGACATGAAGGAGAGAGCCCT GATTGACATGTA

TTCAGAAGGTATTTTAGATCTGACTGAAATGATTGGGCAATTGTTAATATGTCCCCCAGACCAAAAAGAAGCCAAGACTGCCTTGGCAAAAGACAGGACC

AAAAACCGTTACTTGCCTGCCTTTGAAAAG GTGTTGAAGGGCCATGGACAAGACTACCTTGTGGGCAACAGGCTGACCAGGGTGGACGTCCACCTGCTG

GAACTTCTCCTCTATGTTGAAGAGTTTGATGCCAGCCTTCTGACTCCTTTCCCTCTGCTGAAG GCCTTCAAGAGCAGAATCAGCAGCCTCCCCAATGTG

AAGAAGTTCCTACATCCTGGCAGCCAGAGAAAGCCTCCCTTGGATGCAAAACAAATTGAAGAAGCAAGGAAGATTTTCAAGTTTTAGTGTGGCTACATTG

ATGGAGCCACAGATACTGGCC
Translation
MAGKPVLHHFNARGRMECIRWLLAAAGVE FEEKFIQSPEDLEKLKKD - UNI28750 - DGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGK

DMKERAL LIDMYSEGILDLTEMIGQLLICPPDQKEAKTALAKDRTKNRYLPAFEK VLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPLL

K AFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKIFKF

For any suggestions or comments, please send an email to unitrap@crg.es