Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074183 (Gsta1)
Chromosomal location
Chr 9: 78078481 - 78090489 (+)
Description
glutathione S-transferase, alpha 1 (Ya) Gene [Source:MGI (curated);Acc:Gsta1-001]
RefSeq_dna
NM_008181 
RefSeq_peptide
NP_032207.3 
MGI
MGI:1095417 
Uniprot/SWISSPROT
P13745 
Uniprot/SPTREMBL
A2RTN4 
Human Ortholog
ENSG00000182793 (GSTA5)
Omim not available
UniTrap UNI20690
Vector Insertion
Chr 9: 78078538 - 78080024
Public Clones not available
Private Clones OST354814 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16033
Vector Insertion
Chr 9: 78080134 - 78082890
Public Clones not available
Private Clones OST467502 (lexicon) OST18010 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098537
Sequence
CACTCCTCTGGAGCTGGACTGTGAGCTGAGTGGAGAAGAAGCCAGGACTCTCACTAG - UNI20690 - ACCGTGAACCACAGTTGCTGCAATGGCCG

GGAAGCCCGTGCTTCACTACTTCAATGCCCGGGGCAGAATGGAGTGCATCAGGTGGCTCCTGGCTGCAGCAGGGGTGGAG - UNI16033 - TTTGAA

GAGAAGTTTATACAGAGTCCGGAAGATTTGGAAAAGCTAAAAAAAG ATGGGAATTTGATGTTTGACCAAGTGCCCATGGTGGAGATTGATGGGATGAAG

CTGGCGCAGACCAGAGCCATTCTCAACTACATCGCCACCAAATATGACCTCTATGGGAAGGACATGAAGGAGAGAGCCCT GATTGACATGTATTCAGAA

GGTATTTTAGATCTGACTGAAATGATTGGGCAATTGGTATTATGTCCCCCAGACCAAAGAGAAGCCAAGACTGCCTTGGCAAAAGATAGGACCAAAAACC

GTTACTTGCCTGCCTTTGAAAAG GTGTTGAAGAGCCATGGACAAGACTACCTTGTGGGCAACAGGCTGACCAGGGTGGACATCCACCTACTGGAAGTTC

TCCTCTATGTTGAAGAGTTTGATGCCAGCCTTCTGACCCCTTTCCCTCTGCTGAAG GCCTTCAAGAGCAGAATCAGCAGCCTCCCCAATGTGAAGAAGT

TCCTACAGCCTGGCAGCCAGAGAAAGCCTCCCATGGATGCAAAACAAATTCAAGAAGCAAGGAAGGCTTTCAAGATTCAGTGAAGCTGCATTGATGGAGC

CACAGATACTGGCCTCTAATGGTTTGCAATTATAAAAAGCAATTGTTGATCCTGGCTATTTTGCAATAATAAAAAATTAACAACTGG
Translation
 - UNI20690 - MAGKPVLHYFNARGRMECIRWLLAAAGVE - UNI16033 - FEEKFIQSPEDLEKLKKD DGNLMFDQVPMVEIDGMKLAQTRA

ILNYIATKYDLYGKDMKERAL LIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEK VLKSHGQDYLVGNRLTRVDIHLLEVLLYV

EEFDASLLTPFPLLK AFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ

For any suggestions or comments, please send an email to unitrap@crg.es