Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074227 (Spint2)
Chromosomal location
Chr 7: 30041351 - 30066667 (-)
Description
serine protease inhibitor, Kunitz type 2 Gene [Source:MGI Symbol;Acc:MGI:1338031]
RefSeq_dna
NM_001082548 NM_011464 
RefSeq_peptide
NP_001076017.1 NP_035594.1 
MGI
MGI:1338031 
Uniprot/SWISSPROT
Q9WU03 
Uniprot/SPTREMBL
Q5D0F2 Q9D8Q8 
Human Ortholog
ENSG00000167642 (SPINT2)
Omim not available
UniTrap UNI10273
Vector Insertion
Chr 7: 30048785 - 30066530
Public Clones KST272 (baygenomics) D166A09 (ggtc) D060D11 (ggtc) E323C07 (ggtc)
CMHD-GT_538E10-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13232
Vector Insertion
Chr 7: 30045450 - 30048613
Public Clones CMHD-GT_341H10-3 (cmhd) CMHD-GT_538E10-3 (cmhd)
Private Clones OST382103 (lexicon) OST361164 (lexicon) OST234079 (lexicon) OST119498 (lexicon)
OST112873 (lexicon) OST76813 (lexicon) OST70489 (lexicon) OST43483 (lexicon)
OST42558 (lexicon) OST41304 (lexicon) OST33485 (lexicon) OST32454 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19743
Vector Insertion
Chr 7: 30044472 - 30045098
Public Clones not available
Private Clones OST382268 (lexicon) OST374338 (lexicon) OST319649 (lexicon) OST285835 (lexicon)
OST270241 (lexicon) OST201510 (lexicon) OST111769 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21198
Vector Insertion
Chr 7: 30041857 - 30043186
Public Clones not available
Private Clones OST338955 (lexicon) OST284714 (lexicon) OST98985 (lexicon) OST66287 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108235
Sequence
GAGGCCTGGCGCGCGGCGCTGGCAGCAGGTCATGGCGCAGCTTTGTGAGCTGCGGCGGGGCCGGGCGCTCCTCGCCTTGGTAGCTTCGCTGCTCCTCTCC

GGGGCCCAGGTGGCCAGCCGAGAACTAGACGTCCACG - UNI10273 - - UNI13232 - AGAACACCACTGATGACATGGCCAGGAACAGGAATG

GAGCCGACTCTTCTGTCCTGAGTG TTTGCTTTGTAGAGCTGTCAGTAGCTGCCCTGTTCCTCTTTTATGCTTAA
Translation
MAQLCELRRGRALLALVASLLLSGAQVASRELDVHE - UNI10273 - - UNI13232 - ENTTDDMARNRNGADSSVLSV VCFVELSVAALFLFY

A
Transcript ENSMUST00000108236
Sequence
GAGGCCTGGCGCGCGGCGCTGGCAGCAGGTCATGGCGCAGCTTTGTGAGCTGCGGCGGGGCCGGGCGCTCCTCGCCTTGGTAGCTTCGCTGCTCCTCTCC

GGGGCCCAGGTGGCCAGCCGAGAACTAGACGTCCACG - UNI10273 - - UNI13232 - AGAACACCACTGATGACATGGCCAGGAACAGGAATG

GAGCCGACTCTTCTGTCCTGAGTG - UNI19743 - TTCCCAGAAAGCAGAGTGCTGAGGACCTGTCTGCTGAGATCTTCAACTATGAAG AATACTG

TGTCCCGAAGGCCGTCACTGGGCCGTGCCGCGCAGCCTTCCCTCGCTGGTACTATGACACTGAAAAGAATTCCTGTATCAGCTTCATCTACGGCGGGTGC

AGAGGCAACAAGAACAGTTACCTCTCCCAGGAAGCATGCATGCAGCACTGCTCTG GTAAGCAGATGCATCCTTTCCTGACCCCGGGCCTAAAAG - UN

I21198 - CGGTGATCCTGGTGGGGCTGTTCCTCATGGTTCTGATCCTCCTCCTGGGAACCTCTATGGTCTGCCTCATCCGTGTGGTTCGCAGAAAGCA

GGAGCGTGCGCTGCGCACTGTTTGGAGCACTGCGGATGACAAGGAGCAGCTGGTGAAGAACACCTGTGTCTTGTAGAGGCCCCAGTGCTCAGAACCGGGA

GTGACAACTTGTGCTGTTTAAAAAGAGAGCAACTGCTTGCGTCTGAGATCATTAGGGGTTTGGTCTTTGTTTCCCAGTGCTGTTGGGCTGCTTAGGGCCT

CCTCTTGACCCTGTCCTCCCACAGCTCCCCTGCCCTTCCCCATCGCCTGTCTCCTCTAACATCACTAGGAAGGAGCCCCATTCTTGTAGCGGTCACTGTT

TGTTTGATTTATGTGGGTTTTTTTTTTTTTTAAGTAGATAAAGGTTTTTTAAAAAATCAGGATTCTGAAAGAATGTGTTTAATAAAGTGGGCCTTTTAAA

ATAAAACTTACTATG
Translation
MAQLCELRRGRALLALVASLLLSGAQVASRELDVHE - UNI10273 - - UNI13232 - ENTTDDMARNRNGADSSVLSV - UNI19743 - VP

RKQSAEDLSAEIFNYEE EYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSG GKQMHPFLTPGLKA - UNI21198 

- AVILVGLFLMVLILLLGTSMVCLIRVVRRKQERALRTVWSTADDKEQLVKNTCVL
Transcript ENSMUST00000098604
Sequence
GAGGCCTGGCGCGCGGCGCTGGCAGCAGGTCATGGCGCAGCTTTGTGAGCTGCGGCGGGGCCGGGCGCTCCTCGCCTTGGTAGCTTCGCTGCTCCTCTCC

GGGGCCCAGGTGGCCAGCCGAGAACTAGACGTCCACG - UNI10273 - AGTCTTGTGGAGTTTCGAAGGTAGTGGGGAAATGCCGGGCTTCCATCCC

CAGGTGGTGGTACAATATCACTGATGGGTCCTGCCAGCCATTTGTTTATGGAGGCTGTGAAGGCAATGGCAATAACTACCAGAGCAAGGAGGAGTGTCTT

GACAAGTGTGCTGGTGTCACTG - UNI13232 - AGAACACCACTGATGACATGGCCAGGAACAGGAATGGAGCCGACTCTTCTGTCCTGAGTG - U

NI19743 - TTCCCAGAAAGCAGAGTGCTGAGGACCTGTCTGCTGAGATCTTCAACTATGAAG AATACTGTGTCCCGAAGGCCGTCACTGGGCCGTGC

CGCGCAGCCTTCCCTCGCTGGTACTATGACACTGAAAAGAATTCCTGTATCAGCTTCATCTACGGCGGGTGCAGAGGCAACAAGAACAGTTACCTCTCCC

AGGAAGCATGCATGCAGCACTGCTCTG GTAAGCAGATGCATCCTTTCCTGACCCCGGGCCTAAAAG - UNI21198 - CGGTGATCCTGGTGGGGCT

GTTCCTCATGGTTCTGATCCTCCTCCTGGGAACCTCTATGGTCTGCCTCATCCGTGTGGTTCGCAGAAAGCAGGAGCGTGCGCTGCGCACTGTTTGGAGC

ACTGCGGATGACAAGGAGCAGCTGGTGAAGAACACCTGTGTCTTGTAGAGGCCCCAGTGCTCAGAACCGGGAGTGACAACTTGTGCTGTTTAAAAAGAGA

GCAACTGCTTGCGTCTGAGATCATTAGGGGTTTGGTCTTTGTTTCCCAGTGCTGTTGGGCTGCTTAGGGCCTCCTCTTGACCCTGTCCTCCCACAGCTCC

CCTGCCCTTCCCCATCGCCTGTCTCCTCTAACATCACTAGGAAGGAGCCCCATTCTTGTAGCGGTCACTGTTTGTTTGATTTATGTGGGTTTTTTTTTTT

TTTAAGTAGATAAAGGTTTTTTAAAAAATCAGGATTCTGAAAGAATGTGTTTAATAAAGTGGGCCTTTTAAAATAAAACTTACTATG
Translation
MAQLCELRRGRALLALVASLLLSGAQVASRELDVHE - UNI10273 - ESCGVSKVVGKCRASIPRWWYNITDGSCQPFVYGGCEGNGNNYQSKEECL

DKCAGVTE - UNI13232 - ENTTDDMARNRNGADSSVLSV - UNI19743 - VPRKQSAEDLSAEIFNYEE EYCVPKAVTGPCRAAFPRWYYDT

EKNSCISFIYGGCRGNKNSYLSQEACMQHCSG GKQMHPFLTPGLKA - UNI21198 - AVILVGLFLMVLILLLGTSMVCLIRVVRRKQERALRTVW

STADDKEQLVKNTCVL

For any suggestions or comments, please send an email to unitrap@crg.es