Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074251 (AC161410.3)
Chromosomal location
Chr 8: 73550691 - 73695355 (+)
Description
not available
UniGene
Mm.460794 Mm.463238 
Human Ortholog
ENSG00000180777 (ANKRD30B)
Omim not available
UniTrap UNI34078
Vector Insertion
Chr 8: 73613825 - 73660227
Public Clones IST10016E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110075
Sequence
ATGGAGGAAGTCCTCAATGATGACACCCAGACAGTAAATATTCGCAGAAGGGGACGCTGGTACACCCGCCTGTGGCATTCATGTCTGGGCCTTAGATGCA

TGCGTCCTCAAAAAAAAAAGAAATTTCGTCTCCACTGGATTGGCTATGATCCTATAGGTCCATTACAACGAGCAGCTAGTATGGGTGACCTGGATACAGT

GGAAAGATTAATCCACTCCAGTCAACATCATGTGGATGAATCTGATAGAAGGAACAG GACGTCACTCCATTATGCATGTGCCCACAACCATCCAGACGT

GGTGGCACTATTATTAGAAAATAATTCCAGCATTGATATCCTGGATGATGCAGGCTGTACACCCTTGATTAAG GCCACCCAACGAGACAATGTGGATTG

TGTTTCTGTATTGCTCACCCACAATGCGGATCCAAATCTGATAGATTTCAGTGGGAACACAGCCTTCCACCATGCTGCATCCAGGGGTAACATAAGTATT

GTAAAAATGCTCCTTGAGCACAACGTAGACATTGAAGCCAAAACAGAG TATGGCATGACACCGTTGCAACTTGCAGAATTTGAAGAGAAACCTGAAATG

GTAGAATTTTTAGCAGCGAAGTGTGCAAAAAG CACTGGATCATCAGCTCAGAGAACTGAAGTGAAGCATGTCAGGTTTAACGAAG AAGTCTTATATTT

TGAAGAGGAAAGGCCTTTGTCCTGGTAAGGTTTAACAATTCCTTAATAGTAGGTAAATTCAAAGATAAGAAGCAAATTCTTGTTGTGAGTACTTTGAGAC

CTGTGTCTTACAAGTCCCACAATATTATGAATATATTTTTTAGCTTGGAAACTTGCTCAGTTTAGTTCATAGGAACATGAACACTGTATTCACCCACCAT

TTCCAAGAACCAACTCTGCAGTTTGGAAAAAGAGCCTGCTGGGATTAGCTATGCACATGGATGTCCATTTAAGATTCATTGGCTTTTCAAAGCCTTACTG

AATTCAATTTGTGAACTAAGACCCACACTAGTAGCTATCATTTCAGACATTTCTCTTGTCTGAGAGTTTACATAATTCTGGATGCTTCTCAGTTGTCAGT

CATCACTACAGGATGCCAACAAATTTCTTTCCACTTCTGACAGAACTTTACATGCAAAGGACTTTTTTGTCAGGGGTAGCATCTTTCATAGCTGTTGGAA

GACACCCATGTTTTCCAGAATGCTCCATCCATCAATGATCTGTTCACGTGATCTGTTTTCCATAGTAATGAATCCTTTAACTCTCAGTACATTATCTGAA

TGACAGTGTATCTAATAGTTATCTTTCTACAAAGGAGGCTTTTGTCTTACACATCAGTTGGACATGACCATAGAGGTGAAGGCCCATCCACTCCTGTCCA

GGATGCTAGGTTAGACACAGCTTGATAGAAAACTAAAAGTTGTATTTCGAGCTAATTCTGTGCACATTAGGATTCATTACTTCCACAAGAGAGGACAACT

ATATTGTCCTCTTTATTTGTGCTATGTATCAACAAAACATTTTCTAAACATTATTAAATAGCTTACTGAATCCAAAGGTAATGTGGAAAGTGAAGATTCA

AAAAATTTCAGGACTTAAAGCTCTTCAGAGACTCCTTGAAAAATACATATGTTGACTTCTTTTTAGTTCTAAACAGTTCCACAGTAAAACTGAAAGTGTC

AACTAAATTTTATTGTTCTTTGCTCTTGTTACTCTCTTATTATTTTCCTAGAAATGCTTGTTTGGCATAGAAACAAGCAGACTGTGATATCAGGATTCAG

TCATGCATGAGATAAGAAGGGGCAGCTTGAACATTATGAAAGCTCTGGTGGGTTGGTTAGAGTTCCTGAAATCTATTTGATGGTCCACAAAACATCCACT

TGTGTGGTAACATCATAGTCAATGAAATGTGCACAAAGTATCATGAGAGAAGTACTTTGCTGTTCCAGGGGCAAGGACTGACATTGAGTCAACTGATTAA

AAAAAAAAAAATCTGTCTGTATCATAACAAAGTCAGACGAGGTATCAGTGAGTGTGCGTGTGTGCATGCATGCTTGTCTGTATCTGTGTGTAGTTTTGTT

GGGCTATATTTTGTGGGCTAAATTCTTCCCTTTCTTCCACATGAGGAGAAGTTGTAAGGAAAGTGTCCCCAAACGTAATGAACTGGTTAAAGAACAAGTT

AATAGTTTTTATTGATTTGTAATGTAACATAAATTAGGAAATCAAACAACAAAGAATTCAAAGTCTTTGATTACTGTTTTATATGAAATTAAAATAACAC

TCTTAAAATATGCCACAGTGGAGCAAGACCACCAGGACAGCTTAAATCCATCTTGAAAAACTCTGTCCAGTATAATACAG TTATTGAGAAAATTACTAG

AAGAACATCACTTGGTTTCCTGGATTCCAAGAATGGTTTGTACAG GTGTTCAAAAGCAGAAGATGTCAGGTATACTTCCTGTATCAAG GAAGAATCTA

GCAAAACTTTACTTAGACCACAGAAGAGGATGCAAAAGGGTTTTGTGGGTTTTTGGAGTTCTGGAGTTTATGTGTGTTCTCGGGGAGAGCCGATACCTAA

CAGTTGTGAAGAAAAAGCATCCCTAATG GTGCGAGGAAATAAACCACCTATTTTCCTTCCTGTTCCTGGGAAGCAGGGAATTTATGTGCTTGAGGCTCC

TGGTGACATTGAGCCAACTCAACCCACAAGTGCTGCTGACAGCAGGGCTCCTGCTGATGCTGAGCCAAATTCTTCCACCTGTGCTGCTGTCAATGGGGCT

CCTGTTAATGTTGAGCCAACTCCTTCACAACTTGCACCTGACAGTGGTGCTCCTGCTGATGTTGAGCCAACTACTTCCCAGTGTGCTCCTGACACCAGGG

CTCCTGCTGACATAGAACCAACTCCTTCACAAAGTGCTCCTGACATTCCTGCTCCTCCTGATATTGAGAAAATTACTTCCCCATGTCCTTCTGACAGTTC

TGAATCTGATGAAAAACATGACTTAGAAACAG GTGAGGAACCCAGTCCTGTTGCTGACCTAGATGAAGATATAGCTGAGGATTTTTATGACGCTTTAGA

GTCAGCCGATCTCACTGGCCATAGCGGGTCCACTGTCCAGGTACCTGGTTTTCTTTGGGAACCAGATATGCTACTGCTGCTGGTAATGCCCTTGATGTGG

TTTCTTACATTCCTGTTATCAATGATGATGTGGATTAGAAATCAAATTCGGCAAGTGTGGTATGAAGAAAATGGCCAAGGACCTTCCTCCAACAGAAAAG

ATAAACCCA ATGCCGCTGGAGCTGAACTCTCCAACACACACTGATATATCCAGACAAAATGTGTGAGGAAGATGTTTATTATACATATGTAAATATATA

AATTTTATATATAAATAAAATGTTTTATCTGAT
Translation
MEEVLNDDTQTVNIRRRGRWYTRLWHSCLGLRCMRPQKKKKFRLHWIGYDPIGPLQRAASMGDLDTVERLIHSSQHHVDESDRRNR RTSLHYACAHNHP

DVVALLLENNSSIDILDDAGCTPLIK ATQRDNVDCVSVLLTHNADPNLIDFSGNTAFHHAASRGNISIVKMLLEHNVDIEAKTE YGMTPLQLAEFEEK

PEMVEFLAAKCAKS STGSSAQRTEVKHVRFNEE EVLYFEEERPLSW      
Transcript ENSMUST00000098652
Sequence
AGTTCTGACTGCGCCCATGGTCCTGATTCGCTAATTCTCAGAAACCCAATGGGGAGCCCGGAGCAACGGAATAAGCAACCAGATGATCAGGATCCCAAAT

GGCACTTCGCAGCAGATTTTCTCAGCAAGGGCTTCCTGTGACCTTAATTACATTTAAATAGAGCTTGTACCTGGCTTTGCAGAGCCAATCTGCTTCTGAC

CCTGTTTTTGACCCTGGAGAAAAAGAAGGGCTGTCTAGGCCAGGCAAGACGCACAGGGACAGGACAGTGAGAGGATGTCAAGCTTGAGGAGTTTGGCATG

AGGCAGTCAGTTGACTTTATGGCCAGCTTTTTGCCAAAATTTTCTGTGAATCTATTCAATTTTAGCAAAGAAAAGGAAGAGAATACTATTATCCAATGCA

TACAGAAACTGAAG GCACATTATGGTTGAGGTATGCACCCAGCCCATTGATGCCATTACTCTACTGAAG ATGTAATATGACCTGCTGCCTCATGTTCC

TGCTCCCTTGACTTCTCCATCAGGAAGAATTGTATCTTGAATT GGTTTGTATTCCTGCACAAAACACCATGGCCAAGCAGGAAGTTGGAGAGGAAAGGG

TTTATTCAGCTTAAACTTCCACATTGCTGTGACTCACCAAAGGAAGTCAGGATAGGAACTCATACAAGGCAGGACCTTGGAG AATTCAGGACTACCAGA

TCAGTGATGGCACCACCGACAATGGGCTGATCCCCCTTGATCACTAATTGAGAAAATACTTTAAAGCTGGATCTCATGGAGGCATTTCCTCAAGGGAAGC

TCCTTTCTCTGTGATAACTTCACTCTGTGTCAAGTTGACACACAAACCT GACTTCGCTGCATTATGCATTTGCCCACAACCATCCAGACGTGGTGACAC

TATTATTAGAAAATAATTCCAGCATTAACATCCGGGATGATGAAGGCTGTACACCCTTGATTAAG GCCACCCAACGAGACAATGTGGATTGTGTTTCTG

TATTGCTCACCCACAATGCGGATCCAAATCTGATAGATTCCAGTGGGAACACAGCCTTACACCATGCTATATCCAGGGGTAACATAAGGATTGTAAAAAT

GCTCCTTGAGCACAACGTAGACATTGAAGCCAAAACAGAG TATGGCTTGACACTGTTGCAACTTGCAACATTTGAACAGAAACCTGAAATGGTAGAATT

TTTAGCAGCAAAGTGTGCAAACAG - UNI34078 - CATTGATATCCTGGATGATGCAGGCTGTACACCCTTGATTAAG GCCACCCAACGAGACAAT

GTGGATTGTGTTTCTGTATTGCTCACCCACAATGCGGATCCAAATCTGATAGATTTCAGTGGGAACACAGCCTTCCACCATGCTGCATCCAGGGGTAACA

TAAGTATTGTAAAAATGCTCCTTGAGCACAACGTAGACATTGAAGCCAAAACAGAGGTA
Translation
      MLLEHNVDIEAKTE YGLTLLQLATFEQKPEMVEFLAAKCANS - UNI34078 - SIDILDDAGCTPLIK ATQRDNVDCVSVLLTHNADPN

LIDFSGNTAFHHAASRGNISIVKMLLEHNVDIEAKTEV

For any suggestions or comments, please send an email to unitrap@crg.es