Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000074259 (Gramd2)
Chromosomal location
Chr 9: 59555523 - 59564231 (+)
Description
GRAM domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:3528937]
RefSeq_peptide
NP_001028670.1 
UniGene
Mm.297580 
MGI
MGI:3528937 
Uniprot/SWISSPROT
Q3V3G7 
Uniprot/SPTREMBL
B2RSP5 
Human Ortholog
ENSG00000175318 (GRAMD2)
Omim not available
UniTrap UNI15871
Vector Insertion
Chr 9: 59555567 - 59555806
Public Clones not available
Private Clones OST471239 (lexicon) OST351202 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26997
Vector Insertion
Chr 9: 59555903 - 59557258
Public Clones not available
Private Clones OST79594 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23006
Vector Insertion
Chr 9: 59557317 - 59557668
Public Clones not available
Private Clones OST279099 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098661
Sequence
ATGCAAATGAAGATGATGTTTTTCTGCCTATCAGATTGGCAGAG - UNI15871 - CAACCAACAAATGCACGGGAAGATGGCACCTCTGAAGAGCCA

TGTGCCCTGCACGGAGAAACCAGGAAAGGTCCAGGAGCCTCCAGATGATGGCAG - UNI26997 - TCTGCACTGGTCAGAAGGCTCAAAGGGTGAAG

ACATAAAGAAGTATAGCCGGGAAGGG - UNI23006 - ACACTACGGAGCAAATACAACCAACAATACCACAAGCTGTTTAAAGATATCCCGTTGGAG

GAGGTGGTCCTCAAAG TGTGTTCCTGTGCCCTCCAGAGAGACCTCCTTCTCCATGGTCGGCTCTATATCTCTCCCAACTGGCTTTGCTTCCATGCCAGC

CTCTTTGGCAAGGATATCAAG GTGGTCATTCCTGTGGTATCTGTGCAATTGATCAAAAAACACAAGATGGCACGACTCCTTCCCAATGGACTGGCCATC

ACCACAAACACCAGCCAGAAG TATGTCTTTGTGTCTCTGCTTTCCCGGGACAGTGTATATGACATGCTGAGGAGGGTCTGCACTCACCTGCAG CCTTC

CAGCAAGAAGAGTCTGAGTATAAGGAAATTTCCGGAGGAAGCCGAGTGCGAGTCCCCG GAAGTCCTTATCCCCGAGATGAAGTGGAGAAAAGCATGCTC

AGCCCCCGCATCCCTGTCACTCCCAGACAGCATCTCTTGTATCTCTCAGATCCCGACAGACTCCACAGATAGCTGCTTCCCCTCCAGGAAGCCTCCAGGG

TCTG AGGCCGTCTGTGAGAAAGATGCATTGGAGGAAGAGCCCAGCACGGACCAGGAACTGAGGCTGTGGGATTCTCGGCTCCTCAAGGTCATCTTTGTG

AT GATCTGCTTTCTAGTCCTGTCCTCGTCCTATCTGGCATTCCGAATCTCCAGGCTGGAACAGCAATTATGTTCCCTGAGCTGGGGCAGTCCACTCCCA

AGGGACAG GTAACAGTCACTTGGTCTTCATCCCACACCTTATGCAAGGATGCTCTGGGTGCTGTCTCTACCAAGGATTCCTGGGGTTTATACTGCGGCT

GTGCTGAGACTGAGTATGAAGAACATGTTCTAGATTCTTCCTCCAGACTCCTCCCTAGCACCTCCCTCAGTGAGTGACCTGAAGTACCTGTTTACAGATT

AACTGGCTCCTACAACTTTTGGACTC
Translation
MQMKMMFFCLSDWQS - UNI15871 - SNQQMHGKMAPLKSHVPCTEKPGKVQEPPDDGS - UNI26997 - SLHWSEGSKGEDIKKYSREG - U

NI23006 - TLRSKYNQQYHKLFKDIPLEEVVLKV VCSCALQRDLLLHGRLYISPNWLCFHASLFGKDIK VVIPVVSVQLIKKHKMARLLPNGLAIT

TNTSQK YVFVSLLSRDSVYDMLRRVCTHLQ PSSKKSLSIRKFPEEAECESP EVLIPEMKWRKACSAPASLSLPDSISCISQIPTDSTDSCFPSRKPP

GSE EAVCEKDALEEEPSTDQELRLWDSRLLKVIFVM MICFLVLSSSYLAFRISRLEQQLCSLSWGSPLPRDR R
Transcript ENSMUST00000114056
Sequence
GAAAAGCCTACTATACCCAGAGTAGTGTTTAGATGTGGGGAAATGAGTTCCCTCTCAGAATGCTGGTCTCTGGGTTAATGGGCACAGCATTTGAAAGGTG

GCTCCAAATGATGACATCTTAAACTACCCTGTACATCAAAGGGTAGAGAACAGAGCAGCTGCCCTGGACACAGTGCAGCTAATAGGGAAAGATGCCCCCA

AATTTCTCTTTCTAACATGGACACATTTCCCTCTAGCAACCAACAAATGCACGGGAAGATGGCACCTCTGAAGAGCCATGTGCCCTGCACGGAGAAACCA

GGAAAGGTCCAGGAGCCTCCAGATGATGGCAG - UNI26997 - TCTGCACTGGTCAGAAGGCTCAAAGGGTGAAGACATAAAGAAGTATAGCCGGGA

AGGG - UNI23006 - ACACTACGGAGCAAATACAACCAACAATACCACAAGCTGTTTAAAGATATCCCGTTGGAGGAGGTGGTCCTCAAAG TGTGT

TCCTGTGCCCTCCAGAGAGACCTCCTTCTCCATGGTCGGCTCTATATCTCTCCCAACTGGCTTTGCTTCCATGCCAGCCTCTTTGGCAAGGATATCAAG 

GTGGTCATTCCTGTGGTATCTGTGCAATTGATCAAAAAACACAAGATGGCACGACTCCTTCCCAATGGACTGGCCATCACCACAAACACCAGCCAGAAG 

TATGTCTTTGTGTCTCTGCTTTCCCGGGACAGTGTATATGACATGCTGAGGAGGGTCTGCACTCACCTGCAG CCTTCCAGCAAGAAGAGTCTGAGTATA

AGGAAATTTCCGGAGGAAGCCGAGTGCGAGTCCCCG GAAGTCCTTATCCCCGAGATGAAGTGGAGAAAAGCATGCTCAGCCCCCGCATCCCTGTCACTC

CCAGACAGCATCTCTTGTATCTCTCAGATCCCGACAGACTCCACAGATAGCTGCTTCCCCTCCAGGAAGCCTCCAGGGTCTG AGGCCGTCTGTGAGAAA

GATGCATTGGAGGAAGAGCCCAGCACGGACCAGGAACTGAGGCTGTGGGATTCTCGGCTCCTCAAGGTCATCTTTGTGAT GATCTGCTTTCTAGTCCTG

TCCTCGTCCTATCTGGCATTCCGAATCTCCAGGCTGGAACAGCAATTATGTTCCCTGAGCTGGGGCAGTCCACTCCCAAGGGACAG GTAACAGTCACTT

GGTCTTCATCCCACACCTTATGCAAGGATGCTCTGGGTGCTGTCTCTACCAAGGATTCCTGGGGTTTATACTGCGGCTGTGCTGAGACTGAGTATGAAGA

ACATGTTCTAGATTCTTCCTCCAGACTCCTCCCTAGCACCTCCCTCAGTGAGTGACCTGAAGTACCTGTTTACAGATTAACTGGCTCCTACAACTTTTGG

ACTC
Translation
HLKLPCTSKGREQSSCPGHSAANRERCPQISLSNMDTFPSSNQQMHGKMAPLKSHVPCTEKPGKVQEPPDDGS - UNI26997 - SLHWSEGSKGEDI

KKYSREG - UNI23006 - TLRSKYNQQYHKLFKDIPLEEVVLKV VCSCALQRDLLLHGRLYISPNWLCFHASLFGKDIK VVIPVVSVQLIKKHKM

ARLLPNGLAITTNTSQK YVFVSLLSRDSVYDMLRRVCTHLQ PSSKKSLSIRKFPEEAECESP EVLIPEMKWRKACSAPASLSLPDSISCISQIPTDS

TDSCFPSRKPPGSE EAVCEKDALEEEPSTDQELRLWDSRLLKVIFVM MICFLVLSSSYLAFRISRLEQQLCSLSWGSPLPRDR R

For any suggestions or comments, please send an email to unitrap@crg.es